KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_00307Help
Entry
Btheta7330_00307  CDS       T04540                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
btho  Bacteroides thetaiotaomicron 7330
Brite
KEGG Orthology (KO) [BR:btho00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btho01001]
    Btheta7330_00307 (prkC)
Enzymes [BR:btho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Btheta7330_00307 (prkC)
Protein kinases [BR:btho01001]
 Serine/threonine kinases: Other
  Bacterial family
   Btheta7330_00307 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal PepSY_TM APH
Motif
Other DBs
NCBI-ProteinID: ALJ39903
UniProt: A0A0P0FJL3
LinkDB All DBs
Position
461151..464942
Genome map
AA seq 1263 aa AA seqDB search
MIGKEVLNYTIVSLIGKGGMGSVYLAEHKYIKQQKVAIKVINSDMVNDFTRQRLKEEAEH
LASLNHQNIVRFHDYHIDELGSIYLIMEYADGISLDKYIQTVSGLIVEDKICPLFEPILD
AVEYAHEHNIIHRDIKPANIIITKEGIPKILDFGIATIINRESVEKDDMVMGTPSYMSPE
QVRGDHLDSRSDIYSLGVMLHQMLTGNAPYDTTTLTEYDINKKVVEEPLPRMRTYYKYVS
DKVQKIVDKATAKEPGERYQTCDDFKKALHRVIYPPKIPKWVWTSVAAIVLLMIGGGVYF
WDYNRTKVYYYKDYVEQWGVPQGIGELSSREMSHVNRLYRFEYKKHKLQRMSHVNSKENI
IEDGESERNERPLDMLLYYTDKGNISRAKVLDRSGKVLYVKSYNDKLNTVIFQYDDEYGT
EKTLGAQTIGYVRALEDNGVEKGKISRWLLEYDENGYVSTIRYAGFQNVLVGDAHNIYGR
KYVRDEKGRVLSEHYLSFDGTPKATKWGLGMKKFYYDENDNWVKAEYLTVDGKPAYDDAD
GIGVYVMEYDKYGNVVYALHQDADGKLMLPKKNGVAGIKYIYDQHGFPIEASYLDIDRKA
CFIPNDGFSKVVRKFDDNGYIINQTFYDVDGNQCLSNDGNSSAKYINDNRGNVQEMWFYG
LDGKLNEINEGYAGVKLNYDSIGNIIEYVTYGIDQKPCLKSDGTAGYKAEYNDMNLITKL
VNIGVDLSPCKDNNGIVIAARDYDKRGNQIKVSFYDAGGKTLVLSNENIAGWNSVYDDNG
NETERSFFDDKNNLTVCAGSCAKWISKFDEQGNETNLRYYNLSGKLMMVNGSAGANYKRD
KRGNILEKIEIGTDEQLASGKLIARYKYDKFDNQIEFSVYDRNNKPALNSLDYHKYVCIY
NSRNQRIEIEYYGKDGELTSYNNDKYAIQKDEYDERGYIVRTSYYGKDKQLVVSNEGWAS
STREYDVLGNVLKQSFFGIDGKPTDPKVMVPEGLCRYDRWGNRIYLAAGDGKGHLIINPK
TGWSIQKSEYNSRGKLLSEAYFDENEKPLISRMDGYHKAVISYTSSGNEKEKCYYDIMNK
PMLCPDGYFKEVYEYNDNQQAISLSYLGVNGKSIDCKDGYSKIELTYNKDGEMESRKYTN
ASGRILLTQKWNGKEWVNSSPEPISRNWQQDVRKFNAELPIDFGENTKHLVASSFLVTGS
NSCELSFKTPKSKYEMTEAEVNEYFASIKLVVTKIKSESLPSSVVITGILFDSKGRQLRS
IRK
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaggaggttcttaattataccattgtctctttgataggaaaaggagggatg
ggtagtgtgtatttagcagaacacaaatacattaaacaacaaaaggtagccatcaaggtg
atcaatagtgacatggttaatgattttacccgtcaacgtctgaaagaagaagcggaacat
ttggcaagtcttaatcatcagaacattgttcgtttccatgattaccatattgacgaattg
ggtagtatctacctgattatggaatatgctgatggcattagtctggacaaatatatacag
accgtttctggtttgatcgtggaagataagatttgtccgttattcgagcctatattagat
gcagtggaatatgctcatgaacataatattatccatcgggatataaagcctgcgaatatt
attataaccaaagaaggcattcccaaaattttggattttggtattgctactattatcaat
cgggaatctgtggagaaggatgatatggtgatgggaacaccttcctatatgagtccggag
caggtgagaggtgatcatttagattctagatcggatatatattcgcttggcgtaatgttg
catcaaatgctgacggggaatgctccttatgataccaccacacttactgaatatgatatt
aataagaaagtagttgaagagccattaccacggatgcggacctattataaatatgtatcg
gataaagtacagaagattgtagataaagctactgctaaggaaccgggagaacgctatcag
acatgtgacgattttaaaaaggcattgcatcgggtcatttatcctcctaagattcccaaa
tgggtatggacgagtgtggctgctattgtcttgctgatgataggaggtggagtttatttt
tgggattataatcgtacgaaagtgtattattataaagattatgtcgaacaatggggagtt
cctcagggaatcggagaattgagtagcagggagatgagtcatgtgaacaggctgtatcgt
tttgaatataaaaaacataaactacagcgtatgtctcatgtgaacagcaaggagaatatt
atcgaggatggtgaatcggagcgtaatgaaagaccgcttgatatgttattgtattatacg
gataaggggaatataagccgtgcgaaagtgttggatagaagtgggaaagtattgtatgtg
aagtcatataatgataaattgaatactgtaatatttcaatatgatgatgaatatggaacg
gaaaagactttgggagctcaaactataggatatgtgcgtgcattggaggataatggagtt
gaaaaaggaaaaatatccagatggttgcttgagtatgatgaaaatggatatgtgtcaaca
attcgctatgcaggtttccaaaatgtattagttggtgatgcgcataatatttatgggcgt
aaatatgtgcgtgatgagaaaggtcgtgttttgagcgaacactatttgtcatttgatggt
actccgaaagctacaaaatggggattagggatgaagaaattttattatgatgagaacgat
aattgggtaaaagcagagtatttgactgtagatggtaaacctgcttatgatgacgctgat
ggtattggtgtgtatgtgatggagtatgataaatacggaaatgtggtatatgcccttcat
caagatgctgacgggaaattgatgttgcctaaaaagaatggagttgctgggattaaatat
atatacgatcagcatggattccctatcgaagcttcttatctggatatagatagaaaggca
tgttttatacctaatgacggattttcaaaggtcgttcgtaaatttgatgataatggctat
attataaatcaaactttttatgatgttgatggaaatcaatgtttgtctaatgacggaaac
tcatctgctaaatatatcaatgataatagaggaaatgttcaggaaatgtggttttatgga
cttgatggaaaactaaatgaaataaacgaaggttatgccggagtaaagctcaactatgat
tcaattggtaatataatagagtatgtcacatatggtatagaccaaaagccttgtttgaaa
tcggatggaacggctgggtataaggctgagtataatgacatgaatctgatcactaagtta
gtaaacataggagttgatttatcgccatgtaaagataataatggaattgttattgcagca
agagattatgataaaagaggaaatcaaatcaaagtttctttttatgatgctggaggaaag
actttagttttgagtaatgaaaatattgcagggtggaattctgtatatgatgataatggg
aatgaaacagaacgtagtttctttgatgataaaaacaatcttaccgtatgtgctggaagt
tgtgcaaaatggatatcaaagtttgacgaacaaggtaatgagaccaacttgcgttattat
aatttaagtggaaagttgatgatggtaaatggttctgctggagctaattataaacgagat
aaacgaggtaatatactggagaaaatagaaattggtactgatgaacagttggcttcggga
aaactaatagcaagatataaatatgataaatttgataatcaaatagagttctccgtttat
gacagaaacaataaaccagcgttaaattctttagattatcataaatatgtctgtatctat
aatagtagaaatcagcggattgaaattgagtactatggaaaagatggggagctgacttcc
tataataatgataaatatgcgatccaaaaggatgaatatgatgaacgaggttatattgtt
cgtacttcttattatggaaaagataaacaattagtggtttcaaacgaaggctgggcaagt
tctactcgtgagtatgatgttttaggtaatgtcttaaagcagtctttcttcggtatagat
gggaagcctactgatccgaaagtgatggtaccagaaggtctgtgtagatatgacagatgg
ggaaataggatatatttggccgctggagatgggaagggacatttaattattaatccgaaa
acaggttggagtatccagaaaagcgaatataattctcgtggaaaattattatcggaagct
tattttgatgagaatgagaagcctttgataagccgtatggatggataccacaaagctgtt
atcagttatacttcttcaggtaatgagaaggaaaaatgttattatgatataatgaataaa
cctatgctttgtcctgatggttacttcaaagaagtgtatgagtataatgataatcaacag
gctattagcctatcctatttgggagtaaatggcaagtctattgattgtaaggatggctat
agcaaaatcgaattgacttataataaagatggtgagatggaatctcggaaatacacgaat
gcatctggacggattctgctgacacaaaaatggaacggaaaagagtgggtaaattcatca
cccgaaccaatttcccgaaattggcagcaagatgtacgtaaatttaatgcagaacttcct
attgattttggagagaatactaaacatttagttgcatcgtcatttttagttactggtagc
aattcgtgcgagctcagttttaaaactccgaaatcaaaatatgaaatgacggaagcggaa
gtaaatgagtattttgctagtataaaattggtcgttactaagataaaatcagaaagtttg
ccctctagtgtggtcataacgggaatactgtttgatagtaagggaaggcaattgcgttct
ataaggaagtaa

DBGET integrated database retrieval system