KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_02907Help
Entry
Btheta7330_02907  CDS       T04540                                 

Definition
(GenBank) Sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00511  Other glycan degradation
btho00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Btheta7330_02907
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Btheta7330_02907
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:btho02042]
    Btheta7330_02907
Enzymes [BR:btho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Btheta7330_02907
Bacterial toxins [BR:btho02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Btheta7330_02907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10 BNR_6
Motif
Other DBs
NCBI-ProteinID: ALJ42444
UniProt: C6IEX0
LinkDB All DBs
Structure
PDB: 

Position
complement(3571124..3572758)
Genome map
AA seq 544 aa AA seqDB search
MKRNHYLFTLILLLGCSIFVKASDTVFVHQTQIPILIERQDNVLFYFRLDAKESRMMDEI
VLDFGKSVNLSDVQAVKLYYGGTEALQDKGKKRFAPVDYISSHRPGNTLAAIPSYSIKCA
EALQPSAKVVLKSHYKLFPGINFFWISLQMKPETSLFTKISSELQSVKIDGKEAICEERS
PKDIIHRMAVGVRHAGDDGSASFRIPGLVTSNKGTLLGVYDVRYNSSVDLQEYVDVGLSR
STDGGKTWEKMRLPLSFGEYDGLPAAQNGVGDPSILVDTQTNTIWVVAAWTHGMGNQRAW
WSSHPGMDLYQTAQLVMAKSTDDGKTWSKPINITEQVKDPSWYFLLQGPGRGITMSDGTL
VFPTQFIDSTRVPNAGIMYSKDRGKTWKMHNMARTNTTEAQVVETEPGVLMLNMRDNRGG
SRAVAITKDLGKTWTEHPSSRKALQEPVCMASLIHVEAEDNVLDKDILLFSNPNTTRGRN
HITIKASLDDGLTWLPEHQLMLDEGEGWGYSCLTMIDRETIGILYESSAAHMTFQAVKLK
DLIR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatcattatttatttacccttattctcttgttagggtgctctatctttgtg
aaagcttcagacaccgtttttgtacatcagacgcaaattcctattttaattgagcggcag
gataacgtattgttctactttcgtttagatgcaaaagaaagccggatgatggatgagatc
gttttggattttggaaagagtgtcaatctgtcggatgtacaggcagtcaaactctattat
ggcggtacggaagctttacaagataaaggaaagaagaggtttgcacctgttgactatata
tccagtcaccgtccggggaatacattggcagcaataccgtcttattcgataaaatgtgcg
gaagccttgcagccttctgcaaaagtagttttgaagagtcattataagttgttcccgggg
attaatttcttttggatcagcttgcagatgaagccggagacttctctattcacgaaaata
agttctgaacttcaatcagtgaagatcgatggtaaagaagccatttgtgaagaacggtcg
ccgaaagacatcattcatcgaatggcagtgggcgtccgccatgccggtgatgacggttcg
gcttctttccgtattcccggattggtaacttcaaataaaggaacgctgcttggcgtatat
gatgtccgttataatagcagtgtcgatctgcaggaatatgtagatgtcggtttgagccgg
agcacggatggtggcaaaacatgggaaaagatgcgccttcctctttcgttcggtgaatac
gatggtttgcctgctgcacagaatggagtaggggacccttctattttggtagatacccaa
acgaatacaatttgggttgttgccgcatggacacacggaatgggtaatcaacgtgcctgg
tggagttctcatcccggaatggatctatatcaaacggcacaactggtgatggcaaaaagt
acggatgacggtaaaacctggtcgaaaccgattaatataaccgaacaagtaaaagaccct
tcctggtatttcttgcttcagggaccgggacggggaataacaatgagtgatggaacttta
gtattccctactcagtttatcgactctacccgtgtacctaatgccggtatcatgtatagt
aaagaccgcggaaaaacatggaagatgcacaacatggcacgcaccaatacaaccgaagcg
caagtagtagaaacagagcccggagtgctgatgctgaatatgcgggataaccgtggagga
agccgtgctgtggcaattacaaaagatctgggcaagacatggacagaacatccttcctct
cggaaggccttgcaggaacctgtatgtatggctagtttgatccatgtggaagctgaagat
aatgtacttgataaagatattcttttgttctcgaatccgaatacgaccagaggacgcaat
catataactattaaagctagcctggacgatgggctgacctggcttcccgaacatcagtta
atgctggatgaaggagaaggctggggatatagctgtctgacaatgattgatcgggaaacg
attggtatcttgtatgagagtagtgcagcccacatgacatttcaagctgtaaaactgaaa
gatttgattcgatga

DBGET integrated database retrieval system