KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_03323Help
Entry
Btheta7330_03323  CDS       T04540                                 

Gene name
lacZ_12
Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00052  Galactose metabolism
btho00511  Other glycan degradation
btho00600  Sphingolipid metabolism
btho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Btheta7330_03323 (lacZ_12)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Btheta7330_03323 (lacZ_12)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Btheta7330_03323 (lacZ_12)
Enzymes [BR:btho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Btheta7330_03323 (lacZ_12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Glyco_hydro_2_N BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ALJ42856
UniProt: A0A0P0FC86
LinkDB All DBs
Position
4132606..4135047
Genome map
AA seq 813 aa AA seqDB search
MKHQKQLFTVLLMSAACMLQAQRSETLLEKNWKFSKGDFPEAAQTDYNDTKWESVVIPHD
WAIFGPFDMNNDLQNVAVTQNFEKKASLKTGRTGGLPYVGTGWYRTSFDVPADKEVTLLF
DGAMSEARVYVNGQEACFWPFGYNSFHCNVTPFLNKDGKNNTLAVRLENRPQSSRWYPGA
GLYRNVHLIVTEKVHIPVWGTQITTPHVSDEFAAVRLQTKIENAGEKTEIRIETEILSPD
GKVVTRKENKGRINHGQPFEQNFIVNAPQLWSPESPALYKAVSKVYADNQLVDTYSTRFG
IRNIEYIADKGFYLNGKHRKFQGVCNHHDLGPLGAAINVAALRHQLTLLKDMGCDAIRTS
HNMPAPELVELCDEMGFMMMIEPFDEWDIAKCENGYHRYFNEWAERDMVNMLHNYRNNPC
VVMWSIGNEVPTQCSPVGYKVAKFLQDICHREDPTRPVTCGMDQVTCVLANGFAAMIDIP
GLNYRANRYQEAYDKLPQNLILGSETASTVSSRGVYKFPVKDKKSAQYDDHQCSSYDVEA
CSWSNIPDEDFALADDHHWTIGQFVWTGFDYLGEPSPYDTDAWPNHSSMFGIIDLASLPK
DRYYLYRSIWNKEAETLHILPHWTWPGREGEVTPVFVYTNYPAAELFINGKSYGKQSKNN
SSLKSRYRLMWMDAVYEPGEVKVVAYDKDGKAVAEKSVRTAGKPHHIELVSNRNELTADG
KDLAYVTVKVVDKDGNLCPADSRLINFSVKGAGKYRAGANGDPTSLDLFHLPKMHAFNGM
LTAIVQTNETAGEIILTAKAGGVKAGSIRLLTK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagaaacagttgtttactgtacttttgatgagcgcagcctgtatgctacag
gcacagcgcagcgagacgctgcttgagaagaactggaaattcagtaaaggagattttccg
gaagctgcgcagactgactacaatgatactaaatgggaatcggtcgttatcccgcatgac
tgggccatcttcggacctttcgacatgaacaacgacctgcaaaacgtagcagtcacacag
aactttgagaagaaggcatcactgaaaaccggacgtaccggaggactgccttatgtcgga
accggatggtatcgcaccagcttcgacgttcccgccgataaagaagtcactctcctgttc
gacggagcaatgagtgaagcgcgtgtatacgtcaacggacaggaggcttgcttctggccc
ttcggctacaactctttccattgcaacgtcacccctttcctgaataaagacggaaagaac
aatacactggcggtacgcctcgaaaaccgcccccagtcttcacgctggtatccgggagca
ggtctgtaccgcaacgtccacttgatcgtgacggagaaagtacacattccggtatggggc
acgcagattactaccccgcatgtcagtgatgaatttgccgccgtacgcctgcaaaccaag
atagagaatgccggcgaaaagacagaaatccgtatagaaacggaaatcctgtcgccggac
ggaaaggtagtgacccgcaaagaaaacaaaggccgcatcaaccacggacagccctttgaa
cagaactttatcgtcaacgcgcctcaactctggtcaccggaaagccccgctctttacaag
gctgtatcgaaagtgtacgcagacaaccaactggtagatacatactctacccgcttcggt
atccgcaacattgaatacattgccgacaaaggtttctacctgaacggaaaacaccgcaaa
ttccaaggtgtatgcaaccaccatgacttaggtccgctgggtgcggccatcaacgtagcg
gcacttcgccaccagctcacactcttaaaggatatgggatgcgacgccattcgtacttcc
cataatatgccggctcccgaacttgtggagttgtgcgacgaaatgggattcatgatgatg
atcgaaccgttcgacgaatgggacatcgccaagtgtgaaaacggatatcaccgttacttc
aacgaatgggcagaacgcgatatggtgaatatgctgcacaactatcgtaacaatccctgt
gtagtgatgtggagtatcggtaatgaagtccccacgcaatgcagccctgtaggatataaa
gtagccaagttcctgcaagatatctgccaccgtgaagaccctacccgccccgttacctgc
ggcatggaccaagtgacttgtgttctagccaacggatttgctgccatgatcgatatcccc
ggtctgaactaccgcgccaatcgctatcaggaggcgtatgacaaacttccgcaaaatctt
attctgggtagtgaaactgcgtccaccgtcagctcacgcggtgtctacaagtttcccgta
aaagataagaaaagtgcccagtacgatgatcatcaatgttcttcttatgacgtagaggca
tgttcatggtccaacatccccgatgaggacttcgctttggcggacgatcatcactggacc
atcggacagtttgtatggaccggcttcgattatctgggtgaaccttccccttatgatact
gatgcctggcccaatcatagttccatgttcggtattatcgaccttgccagtctccccaaa
gaccgctattacttgtatcgcagcatatggaataaggaagcggaaacactgcatatcctg
ccgcattggacatggccgggacgcgaaggtgaagtaactccggtatttgtttacaccaac
taccctgctgccgaactgtttatcaacggaaaaagctacggtaaacaaagcaagaacaac
agttcactgaaaagccgctaccgtctgatgtggatggatgccgtatatgaaccgggtgaa
gtgaaagtagtagcctacgataaagacggaaaagcagtagcagaaaagagtgtacgcacc
gcaggcaagcctcatcacatcgaactggtcagcaaccggaacgaactgacggcagacggc
aaagacctcgcttatgtgacagtgaaagtggtggacaaagacggcaacctctgccctgcc
gacagtcgtctgatcaacttctccgtcaaaggtgccggaaaataccgtgccggagccaac
ggtgaccccacgagtctcgacctgttccatcttccgaagatgcacgctttcaacggaatg
cttacagctatcgtacaaacaaatgaaacagccggagaaattattctgactgccaaagcc
ggtggagtgaaagcaggaagtatccgtcttctgacgaaataa

DBGET integrated database retrieval system