KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_03795Help
Entry
Btheta7330_03795  CDS       T04540                                 

Definition
(GenBank) Glycosyl hydrolase family 57
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00500  Starch and sucrose metabolism
btho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Btheta7330_03795
Enzymes [BR:btho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Btheta7330_03795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Spc7 DUF16
Motif
Other DBs
NCBI-ProteinID: ALJ43325
UniProt: A0A0P0FDF9
LinkDB All DBs
Position
complement(4677198..4678580)
Genome map
AA seq 460 aa AA seqDB search
MRTICLYFEIHQIIHLKRYRFFDIGTDHYYYDDYANETGMNEVAERSYIPALSTLIEMVK
NSGGAFKVALSISGVALEQLEIHAPAVIDLLHQLNDTGCCEFLCEPYSHGLSSLANEDCF
REEVLRQRDKMKQMFGKEPKVFRNSSLIYSDEIGGLVASMGFKGMLTEGAKHVLGWKSPH
YVYHCNQAPSLKLLLRDFKLSDDIGLRFSNSEWPEYPLFADKYINWIDALPQEEQVINIF
MELSALGMAQPLSSNILEFLKALPECAKSKGITFSTPTEIVSKLKSVSQLDVPYPMSWVD
EERDTSSWLGNILQREAFNKLYSVAERVHLCDDRRIKQDWDYLQASNNFRFMTTKNTGIW
LNRGIYDSPYDAFTNYMNILGDFIKRVDSLYPVDVDNEELNSLLTTIKNQGEEIAELQKE
VTKWQAKAEKGAAKATKKVAAKKEPVAKATRKKATAKKEE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgatctgtctttatttcgaaatacatcagattatacacttgaaacgctaccgt
tttttcgatatcggcaccgatcattattactatgatgactatgcaaatgaaaccggtatg
aatgaggttgccgaacgatcttatatacctgctctcagcacgttgatcgagatggtgaaa
aactcgggaggagctttcaaagtggcgctttctatttccggtgtggcattggagcaactt
gaaattcatgctccggcggtgattgacttgctgcatcagttgaatgataccggttgttgt
gagttcctttgcgaaccttattcacacggcttgtcatctttggctaacgaagactgcttc
cgtgaagaagtgcttcgccagcgtgataaaatgaaacagatgtttggcaaagaaccgaag
gtgttccgcaattccagcttgatttattcggatgaaataggtggactggtagcttctatg
ggctttaagggaatgctgacggaaggtgcaaaacatgtattgggatggaagagcccgcac
tatgtatatcactgcaatcaggctccaagtctcaaattgctgttgagagactttaaactt
tctgatgatataggattgcgtttctccaattcggaatggccggaatatccattatttgct
gataagtatattaactggattgatgcgttgccacaagaagagcaagtgattaatatcttt
atggaattaagtgcattgggtatggctcagccgctttcttccaatatcctggaattcctg
aaagcattgcccgaatgtgctaaatcaaagggtatcacgttctctactccaacagagatt
gtatctaaattgaaatctgtatctcaactggatgttccttatccaatgtcatgggtggac
gaagaaagagatacaagcagttggctgggtaatatcctgcagcgtgaggctttcaacaag
ttgtatagcgtagcagaacgtgttcacctgtgtgacgaccgtcgtatcaagcaggactgg
gattatctgcaagccagcaacaacttccgtttcatgactaccaagaatacaggtatctgg
ctgaatcgtggcatctatgactctccttacgatgccttcactaactacatgaatatcttg
ggcgactttatcaaacgagtagattcactgtatcctgttgatgtagataatgaagagctt
aactctctgctgactactattaagaatcagggtgaggagatagccgaactgcaaaaggaa
gtaaccaaatggcaggcaaaagctgaaaaaggagctgcaaaagctaccaagaaagtagct
gcgaaaaaggaaccggtagctaaagctactcgcaagaaagctactgcaaagaaagaagaa
taa

DBGET integrated database retrieval system