KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_04593Help
Entry
Btheta7330_04593  CDS       T04540                                 

Definition
(GenBank) Retaining alpha-galactosidase precursor
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00500  Starch and sucrose metabolism
btho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Btheta7330_04593
Enzymes [BR:btho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Btheta7330_04593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ALJ44109
UniProt: A0A0P0FV45
LinkDB All DBs
Structure
PDB: 

Position
5687037..5689253
Genome map
AA seq 738 aa AA seqDB search
MKKRKILSLIAFLCISFIANAQQKLTSPDNNLVMTFQVDSKGAPTYELTYKNKVVIKPST
LGLELKKEDNTRTDFDWVDRRDLTKLDSKTNLYDGFEVKDTQTATFDETWQPVWGEEKEI
RNHYNELAVTLYQPMNDRSIVIRFRLFNDGLGFRYEFPQQKSLNYFVIKEEHSQFGMNGD
HIAFWIPGDYDTQEYDYTISRLSEIRGLMKEAITPNSSQTPFSQTGVQTALMMKTDDGLY
INLHEAALVDYSCMHLNLDDKNMVFESWLTPDAKGDKGYMQTPCNTPWRTIIVSDDARNI
LASRITLNLNEPCKIADAASWVKPVKYIGVWWDMITGKGSWAYTDELTSVKLGETDYSKT
KPNGKHSANTANVKRYIDFAAAHGFDAVLVEGWNEGWEDWFGNSKDYVFDFVTPYPDFDV
KEIHRYAARKGIKMMMHHETSASVRNYERHMDKAYQFMADNGYNSVKSGYVGNIIPRGEH
HYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGGNK
VYHTTILPFTRLVGGPMDYTPGIFETHCNKMNPANNSQVRSTIARQLALYVTMYSPLQMA
ADIPENYERFMDAFQFIKDVALDWDETNYLEAEPGEYITIARKAKDTDDWYVGCTAGENG
HTSKLVFDFLTPGKQYIATVYADAKDADWKENPQAYTIKKGILTNKSKLNLHAANGGGYA
ISIKEVKDKSEAKGLKRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagaaagattttatcgctcatcgcattcctttgcatctcattcattgcgaat
gcccaacagaaattaacctcaccggacaacaatctggtaatgaccttccaagtagactca
aaaggtgccccaacgtatgaactgacgtataagaacaaagtggtaatcaaacccagcact
ctcggactggaactgaagaaagaagataataccagaaccgacttcgactgggtggaccgc
agagacctgacaaaacttgactcaaagaccaacctgtacgacggcttcgaagtaaaggat
acccaaacggctacttttgatgaaacctggcaaccggtttggggagaagaaaaagaaatc
cgcaatcattataacgaactggcagtcaccctgtatcaacccatgaatgaccgttctatc
gttatccgtttccgtctgttcaatgacggtctgggattccgttatgaatttcctcagcag
aagtcactcaattacttcgtgatcaaggaagagcattctcagtttggcatgaacggcgat
catatcgctttctggataccgggtgactatgatacgcaggaatatgactacaccatttcc
cgcttatcagaaatcagagggctgatgaaagaagcgatcactccgaactcttctcagact
cctttctcacagacaggcgtacaaactgcactgatgatgaaaacggatgatggcttatac
atcaatcttcatgaagccgctttggttgattactcatgtatgcacctcaatctggacgac
aagaatatggtattcgaatcctggttgacaccggatgccaaaggagacaaagggtatatg
cagactccctgcaacacaccttggcgtacgattatcgtgagcgatgacgcccgcaatatc
ctcgcttcacgtatcactctcaacctgaacgaaccatgcaagatagcggatgccgcttct
tgggtaaaacccgtgaaatatatcggcgtatggtgggacatgatcaccggaaaaggctca
tgggcttacaccgacgaactgaccagcgtaaaactcggtgaaacggattactccaaaaca
aaaccgaacggcaaacattctgccaacacagccaacgtgaaacgttacattgactttgca
gccgctcacggattcgatgcagtactggttgaaggctggaacgaaggctgggaagactgg
ttcggcaacagcaaagactatgtgtttgatttcgtgactccttatcccgacttcgatgtg
aaggaaatccaccgctatgcagccaggaaaggaatcaaaatgatgatgcatcacgaaact
tccgcttctgtacgcaactacgaacgccacatggacaaagcctaccagtttatggcagac
aatggatacaactccgtaaagagcggttatgtaggcaacatcatcccccgcggcgaacat
cactacggacaatggatgaacaatcactacctgtatgcagtgaagaaagccgccgattac
aaaatcatggtgaatgcacacgaagcaacccgccctaccggtatctgccgtacatatccg
aatctgatcggtaatgaatccgcccgcggtacagaatatgaatcattcggaggcaacaaa
gtatatcatacaacgattctgcctttcacacgcctggttggcggtccgatggattacact
cccggcatcttcgaaacgcattgcaacaagatgaatccggcaaataattctcaggtacgt
tctaccattgcacgccagttggcactatacgttaccatgtacagtcctttgcagatggct
gccgacattccggaaaactacgaacgttttatggacgctttccagttcatcaaagacgta
gctctcgactgggacgaaacgaactatctggaagcagaaccgggagaatacatcacaatt
gcccgtaaggcaaaagatacggacgactggtacgtaggctgcacagccggtgaaaacggt
catacctccaaactcgtattcgacttcctgactccgggcaaacaatacatcgctaccgtc
tacgcggatgccaaagatgccgactggaaagagaacccgcaggcttataccatcaagaaa
ggtattctgacgaataagagcaagctgaacctgcacgcagctaacggaggcggatatgct
atcagcatcaaagaggtaaaagacaaatcagaagctaaaggtttgaaaagattataa

DBGET integrated database retrieval system