KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_01580Help
Entry
YBT1520_01580     CDS       T03435                                 

Definition
(GenBank) holin, SPP1 family protein
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: AHZ49089
LinkDB All DBs
Position
302502..302732
Genome map
AA seq 76 aa AA seqDB search
MRNFDAASISRYVVLVIAVINSVLNLVGYQAIDDKITNDLVAVITGAFTLYMAWKNNYLS
NKGLQQKDVLEKNDLH
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactttgatgcagcttcaattagtcgctatgtcgtattggtgattgctgtgatt
aatagtgtcttaaatcttgtgggataccaagcgattgatgacaaaattacaaacgattta
gtagctgtgattacaggagcattcactttgtatatggcttggaagaacaactatttgagc
aacaaaggattacaacaaaaagatgtattagaaaaaaatgacttacactaa

DBGET integrated database retrieval system