KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_19630Help
Entry
YBT1520_19630     CDS       T03435                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Pathway
bthr00030  Pentose phosphate pathway
bthr01100  Metabolic pathways
bthr01110  Biosynthesis of secondary metabolites
bthr01120  Microbial metabolism in diverse environments
bthr01130  Biosynthesis of antibiotics
bthr01200  Carbon metabolism
bthr01230  Biosynthesis of amino acids
Module
bthr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bthr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YBT1520_19630
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    YBT1520_19630
Enzymes [BR:bthr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     YBT1520_19630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AHZ52536
LinkDB All DBs
Position
complement(3784299..3784841)
Genome map
AA seq 180 aa AA seqDB search
MYKTFTNISEGKNSMSHSIEQLSINTIRTLSIDAIEKANSGHPGMPMGAAPMAYTLWTQF
MKHNPNNPTWFNRDRFVLSAGHGSMLLYSLLHLSGYDVTMDDLKNFRQWGSKTPGHPEYG
HTAGVDATTGPLGQGIATAVGMAMAERHLAAKYNRDAYSVVDHYTYAICGDGDLMEGVSV
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaacgtttactaatataagcgaagggaagaatagcatgtcacattcaatcgaa
caactttctatcaacacgattcgcacattatccatcgatgcgattgaaaaagcaaactct
ggtcacccaggaatgccaatgggtgcagcaccaatggcttatacattatggactcaattt
atgaaacacaatccaaataacccaacgtggtttaaccgtgatcgtttcgtattatctgca
ggtcatggttcaatgttattatacagcctacttcacctatctggttatgatgtaacaatg
gatgacttaaagaacttccgtcaatggggaagcaaaactccaggacatcctgagtacggt
catacagctggtgtagatgcaacgactggtccacttggacaaggtattgcaactgctgta
ggtatggcaatggctgaaagacatttagctgctaaatataaccgtgatgcgtatagtgta
gtagatcattatacatacgctatttgtggtgatggagatttaatggagggcgtttctgtc
tga

DBGET integrated database retrieval system