KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_21975Help
Entry
YBT1520_21975     CDS       T03435                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Pathway
bthr00220  Arginine biosynthesis
bthr01100  Metabolic pathways
bthr01110  Biosynthesis of secondary metabolites
bthr01130  Biosynthesis of antibiotics
bthr01210  2-Oxocarboxylic acid metabolism
bthr01230  Biosynthesis of amino acids
Module
bthr_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    YBT1520_21975 (argJ)
Enzymes [BR:bthr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     YBT1520_21975 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     YBT1520_21975 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ DUF555 DUF2102
Motif
Other DBs
NCBI-ProteinID: AHZ52982
LinkDB All DBs
Position
complement(4234028..4235242)
Genome map
AA seq 404 aa AA seqDB search
MIKVASITKLENGSIVTPKGFSAIGTANGLKKDLGAIVCDVPASCAAVYTTNQIQAAPLQ
VTKDSITAEGKLQAIIVNSGNANACTGMKGLQDAYEMRTLGAEHFGLKENYVAVASTGVI
GVPLPMDIIRKGVATLIPTKEESEAYSFSEAILTTDLITKETCYEMIIDGKKVTIAGVAK
GSGMIHPNMATMLSFITTDAHIEHDVLQTALSQITNHTFNQITVDGDTSTNDMVIVMASG
LSETRPINMEHTDWETFVCALQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAKKIA
KQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVAISPNTIDITLQSILVLKNSEPQTFSEE
EMKERLQEDEIVINVYLHLGEETGSAWGCDLSYEYVKINACYRT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagcgtctattacaaaattagaaaatggttcaattgtaacgccgaaaggc
ttttcggcaattggtactgcaaatggtctgaaaaaggatttaggggcaatcgtttgtgac
gtaccagcatcatgtgccgctgtgtatacaacgaatcaaatacaagcagcccctttgcaa
gtaacgaaggatagtataacggcagaagggaagttacaagcaattatcgttaatagtgga
aatgcaaatgcttgtactggaatgaaaggattacaagacgcatacgagatgcgcacatta
ggggcggaacattttggattgaaagaaaattacgttgcagtagcttcaacaggtgtaatt
ggtgttccgctaccgatggatataatccgaaagggagttgcaactcttataccgacgaag
gaagaaagtgaagcatattctttttctgaagcaattttaacgacggatctcataacgaaa
gaaacttgctatgaaatgattattgatgggaagaaagtgacgattgcgggtgttgcaaaa
ggttcagggatgattcatccgaatatggcaacgatgcttagttttattacgacagatgct
catatagagcatgacgtattgcaaacggcattatcccaaattacgaatcatacatttaat
caaattacggtagatggagatacttctacgaatgatatggtcatcgttatggcaagtgga
ttatcagaaacaaggccgataaatatggaacatacagattgggaaactttcgtatgtgct
ttacagaaggtatgtgaagatttagcaaaaaaaattgcgcaagatggtgaaggcgctacg
aagttaatagaagtaaatgtgctaggagctcaaacgaatgaagaggcaaaaaaaattgca
aagcaaatagtcggttcgagtcttgtgaaaacagcaatacatggtgaagacccaaactgg
ggacgaattattagcagtattggacaaagtgaagtagctattagtccgaatacaattgac
attactcttcaatctatattggtattaaaaaatagtgagcctcaaacattttctgaagaa
gaaatgaaagagagattacaagaagatgaaatagtcattaatgtgtacttacacttagga
gaagagacaggatcagcttggggctgtgacttaagctatgaatatgtgaaaataaacgct
tgttatcgtacataa

DBGET integrated database retrieval system