KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_24300Help
Entry
YBT1520_24300     CDS       T03435                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Pathway
bthr00061  Fatty acid biosynthesis
bthr00620  Pyruvate metabolism
bthr00640  Propanoate metabolism
bthr01100  Metabolic pathways
bthr01110  Biosynthesis of secondary metabolites
bthr01120  Microbial metabolism in diverse environments
bthr01130  Biosynthesis of antibiotics
bthr01200  Carbon metabolism
bthr01212  Fatty acid metabolism
Module
bthr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YBT1520_24300
   00640 Propanoate metabolism
    YBT1520_24300
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YBT1520_24300
Enzymes [BR:bthr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     YBT1520_24300
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     YBT1520_24300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans ECH_1 MdcE
Motif
Other DBs
NCBI-ProteinID: AHZ53439
LinkDB All DBs
Position
complement(4659617..4660591)
Genome map
AA seq 324 aa AA seqDB search
MAELEFEKPVVELRNKIRELKDYTKNSQMDFSEEIRILEEKLENLEEDIYGNLKVWDRVQ
IARHAERPTTLDYIEHLFTDFFECHGDRLFGDDAAIVGGIAKYKGMPVTVIGHQRGKDTK
ENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFIDTKGAYPGKAAEERGQSEAIARNL
FEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLENSTYSVITPEGAAAILWKDAGKAK
EAAEAMKITAADLKELGVIDEIIPETKGGAHRNILKQSENIDLIIRKTFEQLNGISKDEL
IEKRYEKYMKIGQVSFSNASIGIK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctagaatttgaaaaaccagttgttgagctaagaaataagattcgtgaactg
aaagactatacgaaaaacagccagatggacttcagtgaggagattcgtattttggaagaa
aagctagaaaatttagaggaagatatatacggcaatctaaaagtatgggaccgtgttcaa
attgctcgtcatgcagaacgaccgacaacgctcgattatattgagcacttatttactgat
tttttcgaatgtcatggagatcgtctatttggcgatgatgcagcgattgtcggcggcatt
gcgaaatataaagggatgcctgtaactgtaattgggcatcagcgcggaaaagatacgaaa
gaaaatattcgccgtaactttggaatgcctcatccagaaggatatcgaaaagcactgcgt
ctcatgaaacaagcggaaaagtttaatcgtcctattatttgtttcatcgatacgaaggga
gcttatcctggtaaagcagctgaagaacgtggacaaagtgaagctattgcccgcaaccta
tttgagatggcaggtttaacggtaccagttatttgtatcgttatcggtgaaggcggtagt
ggtggtgcgctaggccttggagtaggagattacattcatatgctagaaaattccacttat
tctgttattacaccagagggtgcagcggcaattctttggaaagatgcaggaaaagcaaag
gaagctgcagaggcaatgaaaattacagcagcagatttgaaagaattaggtgtaattgat
gaaattattccagagacaaaaggtggagctcaccgtaatattttgaaacagtcagaaaat
atagacttaataattagaaaaacttttgaacaattaaacggaatttcgaaagatgaatta
atcgaaaaacgttatgaaaaatatatgaaaattgggcaagtttcgttttcaaacgcttcc
attgggataaaataa

DBGET integrated database retrieval system