KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_27490Help
Entry
YBT1520_27490     CDS       T03435                                 

Definition
(GenBank) putative mutator MutT protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bthr03400]
    YBT1520_27490
Enzymes [BR:bthr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     YBT1520_27490
DNA repair and recombination proteins [BR:bthr03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    YBT1520_27490
 Prokaryotic Type
    YBT1520_27490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AHZ54070
LinkDB All DBs
Position
complement(5240569..5241027)
Genome map
AA seq 152 aa AA seqDB search
MQRVTNCVLIRDNEVLLLQKPRRNWWVAPGGKMERGETVRDSVVREYREETGIYLKNPAL
KGVFTFVIQEGDKVVSEWMMFSFLATDFAGENKLESEEGIIGWHTFDKIDDLAMAPGDYH
IIDYLIKGNGIIYGTFVYTPDFELLSYRLDPS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagtgacaaactgtgtgttaattagagataatgaagtactcttactccaaaaa
cctcgccggaattggtgggttgcaccaggcgggaaaatggagcgtggtgagactgtaaga
gattccgttgttcgcgaatatcgcgaagaaacaggtatttatttgaaaaacccagcgtta
aagggggtcttcacctttgtcatccaagaaggtgataaagttgtttctgaatggatgatg
ttctcctttttagcgacagattttgcaggagaaaacaaactagagagcgaagaaggcatc
attggttggcatacatttgataaaattgatgatttagcaatggcgccaggagattatcac
attattgattatttaattaaaggaaatggcataatctacggtacatttgtatatacccca
gattttgagttgctttcatatcgattagatccgagttaa

DBGET integrated database retrieval system