KEGG   Brochothrix thermosphacta: CNY62_08655Help
Entry
CNY62_08655       CDS       T05089                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bths  Brochothrix thermosphacta
Pathway
bths00473  D-Alanine metabolism
bths00550  Peptidoglycan biosynthesis
bths01100  Metabolic pathways
bths01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bths00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CNY62_08655
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNY62_08655
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CNY62_08655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bths01011]
    CNY62_08655
Enzymes [BR:bths01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CNY62_08655
Peptidoglycan biosynthesis and degradation proteins [BR:bths01011]
 Precursor biosynthesis
  Amino acid ligase
   CNY62_08655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ATF26448
UniProt: A0A1D2KKK7
LinkDB All DBs
Position
1791300..1792409
Genome map
AA seq 369 aa AA seqDB search
MKQTVVVFYGGKSAEHEVSVVSAFSVIKALDYNQFNIQPMYISYEGNWIKGPELQAPIQN
SEQLKFTISETGDVLLGDGEKTQSVGQKINIAEFAALENIIAFPVLHGPNGEDGTIQGLF
ETLNIPYVGANVIASSTGMDKIVSKEIFKAVDIPQVPFVAVRNVDWQDSKLEMIEAINTL
NYPVFVKPANMGSSVGISKVMKESELDAAMTEAFLFDRRIVVEQGVTAREIEVAVLGNER
PEVSLAGEIMPKGDSHAFYTYKAKYADTSTELIIPSPLDDGVYDQIVEYAKQAYIALDGT
GVSRADFFVTADNSIYLNELNTMPGFTPVSMFPLLWAESGLPYGELLNRMIELAMERYEQ
KSRLQNKNN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacagtggtggttttttatggagggaagtctgctgaacatgaagtatcagtg
gtttcagctttttcagttattaaagcattagattataatcaatttaatatacaaccgatg
tacatcagctatgaaggaaattggattaaagggccagaattgcaagcgcctatccaaaat
tcagaacagttgaaatttactattagtgaaacaggtgatgttttattaggcgatggcgaa
aaaacacaatctgtaggacaaaaaattaatattgccgagtttgcagcattagaaaacatc
attgcttttcctgtcttacatggtcctaatggagaagatggaacaattcaaggtttattc
gaaacattaaatatcccttatgtgggagctaacgttatcgcatcatcaacaggtatggat
aaaattgtttctaaagagatcttcaaagcagttgatatcccacaagtaccttttgttgcg
gtcagaaatgttgactggcaagactctaaattagagatgattgaagcgataaatacgctg
aattatccagtatttgttaaaccagcgaatatgggatcaagtgtcggtatttcaaaagta
atgaaagaatcagaattggatgctgctatgacagaagcattcctatttgaccgccgtatc
gtcgttgagcagggcgttacagctcgagaaatcgaagttgcggtacttgggaacgaaaga
cctgaagtctcgttagcgggcgaaataatgcctaaaggcgacagtcatgctttttataca
tataaagctaaatatgcggatacatcaacagagctcattattccatcgcctttagatgat
ggtgtgtatgatcaaattgttgagtatgctaagcaagcttatatcgctttagacggtact
ggtgtgtcgcgtgcggatttctttgtaacggcagacaacagtatctatttaaatgaatta
aacacaatgccaggctttacaccagtcagcatgttcccgctcttgtgggcagaatcaggg
ttgccatatggtgagctgctcaatcgaatgatcgaattagcaatggagcgttatgagcag
aaatcccgcttgcaaaataagaataattaa

DBGET integrated database retrieval system