KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch0525Help
Entry
H175_ch0525       CDS       T02474                                 

Definition
(GenBank) neutral protease
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Brite
KEGG Orthology (KO) [BR:btht00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btht01002]
    H175_ch0525
Enzymes [BR:btht01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     H175_ch0525
Peptidases [BR:btht01002]
 Metallo Peptidases
  Family M4: thermolysin family
   H175_ch0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AGF99238
UniProt: M1QG58
LinkDB All DBs
Position
602364..604064
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPIKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRTTL
PGTLWLDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSDLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGASSAEVNAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcatttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatttaactggagcgactggtaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtacctgtatggggttctactcaagtagct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttaaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaatggtgaagaaacaacatatgcatatgttgtaaatctaaatttcttagatcca
agtccaggaaactactactatttcattgaagcagacagcggtaaagtattaaataaatat
aataaattggatcatgtagcaaatgaagataaatcaccaattaagcaagaggctcctaaa
caggatgcgaaagcagtagtaaaacctgtaacaggaacaaataaagtaggaactggtaaa
ggtgtattaggagatacgaaatcactcaatacaacattatctggctcatcttactactta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaatcgtactacattg
ccaggaactttatggttagatgcagataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtaaaacatatgattattataaagctacatttaataga
aactctattaatgatgcaggggcaccgttaaaatcaacagttcattacggaagtaagtat
aataatgcattctggaacggctcacaaatggtatacggagatggagatggtgtaacattc
acttcattatctggtggaattgacgtaattggtcacgaattaacgcatgctgttacggaa
aatagctcggacttaatttatcaaaatgaatcaggagcgttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccagattgggagattggtgaa
gatatttacacgcctggtaaagcaggagatgcgcttcgctctatgagtgatccagcgaaa
tatggtgacccagaccattattctaagcgttacactggtactagtgataacggtggggtt
catacaaacagtggtatcattaacaaacaagcttatttattagcaaatggtggtacgcat
tcgggtgtaactgtaacgggcattggtaaagataagttaggtgcaatttattaccgtgca
aatacacaatatttcacgcaatctactacatttagccaagctcgtgctggtgcagtacaa
gctgcagcggatttatatggtgctagctctgcagaagtaaatgcagtgaagcaatcattt
agtgctgttggtgtaaattaa

DBGET integrated database retrieval system