KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch2052Help
Entry
H175_ch2052       CDS       T02474                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00473  D-Alanine metabolism
btht01100  Metabolic pathways
btht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    H175_ch2052
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    H175_ch2052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btht01011]
    H175_ch2052
Enzymes [BR:btht01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     H175_ch2052
Peptidoglycan biosynthesis and degradation proteins [BR:btht01011]
 Precursor biosynthesis
  Racemase
   H175_ch2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimerisation
Motif
Other DBs
NCBI-ProteinID: AGG00765
UniProt: M1QUL5
LinkDB All DBs
Position
2046050..2047225
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYIEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENITVEEIADMLSTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagctgga
ataaatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatata
gaagtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcaggatcaatggaattaagtaacacatttcaa
aatatggtgcgcgttggaataggagtgtacggtatgtatccatcaaaagaggtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtggctcatattaaacat
gcgaagaaaaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacggggttcgagtacctgtaattggccgtgtttgtatggatcagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcacagtagaagaaatagcggatatgttaagtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtttataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system