KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch4038Help
Entry
H175_ch4038       CDS       T02474                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00010  Glycolysis / Gluconeogenesis
btht00020  Citrate cycle (TCA cycle)
btht00620  Pyruvate metabolism
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
btht01130  Biosynthesis of antibiotics
btht01200  Carbon metabolism
Module
btht_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H175_ch4038
   00020 Citrate cycle (TCA cycle)
    H175_ch4038
   00620 Pyruvate metabolism
    H175_ch4038
Enzymes [BR:btht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H175_ch4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AGG02750
UniProt: M1QZX2
LinkDB All DBs
Position
complement(3994267..3995556)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAEATPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGTGKNGRIVKADIDAFANGGQTVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPTEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagacgatgtacttcttgaagtgcaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaatcgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatacgctcgtgaaaaaggtgtagacattcat
aaagtggctggtactggtaagaacggccgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaattccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaagcat
acagctcctcacgtaacattaatggatgaagttgatgtaactgagcttgttgctcaccgt
aagaagttcaaagcagtagcagctgacaaaggtattaaattaacttaccttccatacgtt
gttaaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagacgat
gcatctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcactatttct
aacgagatcaatgatcttgctggtaaagcacgtgaaggtcgtctagctccaactgaaatg
aaaggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaatcacccagaagtagcaatccttggtatcggccgtatcgctgaaaaaccagtt
gtgaaaaatggtgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcgttaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system