KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch5150Help
Entry
H175_ch5150       CDS       T02474                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Brite
KEGG Orthology (KO) [BR:btht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H175_ch5150
Enzymes [BR:btht01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H175_ch5150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AGG03859
UniProt: M1QUC8
LinkDB All DBs
Position
5013200..5014105
Genome map
AA seq 301 aa AA seqDB search
MINGCFFCPIYLYIWKTKEGTMMKRTIVMIVMIATLFTGMIFFSYAQRQQAVRADQPNIT
GQYGVTIDAKTGEILYGKREDERSYPASIAKMMTTLLLLENVKEDEEITVTENAIKTESQ
SKKIKLRAGEKLKRDEALKLMLIISADPIAESIAEHIAGSKNEFVKMMNARAKELGTKHA
TFKNASGADAIGNKVSPYDIAIITKEALKYPVVLEYMNSTRTTLHTSERSPNIANYGREE
LYDDPYAIGSKSGLSALGKYTVVTVDEKDGKRVINVVLSSTRAQLYPDTKKMAHYAFQQL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggctgctttttctgcccaatttatttgtacatatggaaaacaaaagaggga
acgatgatgaaacgaacaatagttatgattgtaatgattgctacactatttacaggaatg
attttcttctcttatgcacaaaggcaacaagctgtaagagctgatcaacctaatattact
gggcaatatggagttacaatcgatgcaaaaacaggtgaaattttgtatgggaaacgcgaa
gacgaacgttcttatccggctagtatagccaaaatgatgacaacccttcttttactagag
aatgtaaaagaagatgaagaaattacggttacagaaaatgcaattaaaacagaaagtcaa
agcaagaaaattaaacttcgtgctggagaaaaattaaagcgtgatgaggcattaaaactt
atgcttatcattagtgcagatccaatagctgaatcaattgcagaacatatcgcaggatca
aaaaatgaatttgtgaaaatgatgaatgctagagcaaaggaacttggtacaaagcatgca
actttcaagaacgcaagtggtgctgatgcaattgggaataaagtatcaccatatgacatt
gctattattacgaaagaagcattaaagtatccagttgttttagaatatatgaattcaaca
cgtacaactctacatacttcagaacgctctccaaacatcgcaaactatggacgagaagaa
ctatatgacgatccatatgcgattggaagtaaaagcggtctatcagcactcggcaaatat
acagtcgtaacagtggatgaaaaagacggtaaacgcgtcattaacgtcgtattatcttct
actcgcgcgcaactatatcctgatacgaaaaaaatggcgcattacgcatttcagcaatta
aaataa

DBGET integrated database retrieval system