KEGG   Bacillus thuringiensis YBT-1518: YBT1518_07140Help
Entry
YBT1518_07140     CDS       T02930                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00061  Fatty acid biosynthesis
bthu00780  Biotin metabolism
bthu01100  Metabolic pathways
bthu01130  Biosynthesis of antibiotics
bthu01212  Fatty acid metabolism
Module
bthu_M00083  Fatty acid biosynthesis, elongation
bthu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YBT1518_07140
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YBT1518_07140
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YBT1518_07140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bthu01004]
    YBT1518_07140
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     YBT1518_07140
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     YBT1518_07140
Lipid biosynthesis proteins [BR:bthu01004]
 Fatty acid synthase
  Component type
   YBT1518_07140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AHA70628
UniProt: V5M8Y3
LinkDB All DBs
Position
1457612..1458382
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTPEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgtcgttatgggcgttgcgaaccaaagaagtatt
gcatggggaattgctcgctctttgcataatgcaggtgcaaaattaatattcacatatgca
ggagaacgtttagaaagaaatgttcgtgaattagcggacacattagaaggacaagaatca
cttgtattaccttgtgatgtaacgaatgatgaggaacttacagcttgctttgaaacaatt
aaacaagaagtaggtactattcacggtgtagcacattgtattgcttttgcaaatcgcgat
gacttaaaaggtgaatttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agtgcattctctttaacagctgtagcaagagaagcgaagaaagtaatgacagaaggcgga
aatattttaacgttaacataccttggcggcgagcgcgttgtgaaaaattataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaaatatttagcgaacgatttaggtcaa
catggtattcgcgtcaacgctatttctgcaggaccaattcgtacgttatctgcaaaaggt
gtaggcgatttcaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaactccagaagaagttggcgatacagcagtattcctattcagtgatttagcacgcggt
gtaacaggagaaaacattcacgttgattcagggtatcatatcctaggataa

DBGET integrated database retrieval system