KEGG   Bacillus thuringiensis YBT-1518: YBT1518_11490Help
Entry
YBT1518_11490     CDS       T02930                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00473  D-Alanine metabolism
bthu01100  Metabolic pathways
bthu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    YBT1518_11490
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    YBT1518_11490
Enzymes [BR:bthu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     YBT1518_11490
Peptidoglycan biosynthesis and degradation proteins [BR:bthu01011]
 Precursor biosynthesis
  Racemase
   YBT1518_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimerisation
Motif
Other DBs
NCBI-ProteinID: AHA71481
UniProt: V5M8F7
LinkDB All DBs
Position
2260653..2261828
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYIEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENITVEEIADMLSTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagctgga
ataaatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatata
gaagtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcaggatcaatggaattaagtaacacatttcaa
aatatggtgcgcgttggaataggagtgtacggtatgtatccatcaaaagaggtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtggctcatattaaacat
gcgaagaaaaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacggggttcgagtacctgtaattggccgtgtttgtatggatcagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcacagtagaagaaatagcggatatgttaagtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtttataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system