KEGG   Bacillus thuringiensis YBT-1518: YBT1518_11790Help
Entry
YBT1518_11790     CDS       T02930                                 

Definition
(GenBank) bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00860  Porphyrin and chlorophyll metabolism
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
bthu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YBT1518_11790
Enzymes [BR:bthu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     YBT1518_11790
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YBT1518_11790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AHA71541
UniProt: V5M8N1
LinkDB All DBs
Position
complement(2312641..2314065)
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAIECLNRADIVLYDRLLNPSFLNYTKETCELIYCGKMPK
NHTMRQEMINSHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLASANIPYEIVPGITSS
IAASIYAGIPLTHRDYSNSVTLLTGHAKGPLSDHGKYNSSYNSDTIAYYMGIKNLPTICE
NLLQAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRNQ
ISWKERKPLHSKKVLFASATNKKSAIKQMLQESGAEIYQIPTFKKKEYTLTSEQINKIFN
VDRLVFCSADSVDILMQSCSKYHKDIRSLQAELHYMNLSIQEKLMQYGLFSKPAQFSSNS
TIYLGRNINRIAVIQEKIGAGSYMMTHEYTIDHRFDEIHSRILSEFSWDSIVFEGRASID
TFLAEIKRLGFINILTLPFSYTDVPTLHYANKVGFHNVDHQLQETLMKKDMVRQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggaccaggtgatgaagggcttattacaaaa
aaagcgatagagtgcttaaatcgtgcagatatcgtcttatatgaccgcttattaaaccct
tcctttcttaattatacaaaagaaacatgtgaacttatttattgcggaaaaatgccaaag
aatcatactatgcgtcaagaaatgattaactcacacctccttcaatttgcgaaagaagga
aaaatcgtagtccgcttaaaaggcggagatccatctatttttggccgtgttggtgaagaa
gcagaaactttagcatcagcaaatattccatatgaaattgtaccaggtattacatctagc
atcgccgctagtatctatgcaggtattcccctcacccaccgtgactacagtaatagtgtc
actttattaactggacatgcaaaaggtcctttaagcgatcatggaaaatataattcatct
tacaatagcgacacgattgcctactacatgggtataaaaaacttacctacaatttgtgaa
aacttactacaagcaggaaaaaaagaagatacgccagtagcagtcattgaatggggtaca
actggtaaacagcgcgttgtcacagggacactgtctaccattgtttctattgtcaaaaac
gaaaatatttctaatccttctatgacaattgttggtgatgtcgtttccttacgtaatcaa
atctcttggaaagaacgcaagccattgcacagcaagaaagttttatttgcatctgcaaca
aataaaaaaagcgcaataaagcaaatgttacaagagtccggtgcagaaatatatcaaatt
ccaactttcaaaaagaaagaatacacattaacctctgaacaaatcaataagatttttaac
gttgatcgtcttgtattttgttccgctgacagtgtagacatcttaatgcaatcatgcagt
aaatatcataaagatattcgttccttacaggcagaacttcactatatgaacctttctatt
caagaaaagctcatgcaatatggattgttcagtaaacctgcgcaattttcttcgaattca
acgatttatttaggacgaaacattaaccgaattgctgttattcaagaaaaaattggtgct
ggttcctatatgatgactcatgagtacacaattgatcatcgcttcgatgaaattcattca
cgtattctttctgaattctcatgggatagcattgtatttgaaggtcgtgcttctattgat
acgtttctagcagaaataaaacgccttggctttatcaatattcttactctcccattctcg
tataccgacgttccaactttacactatgcaaataaagttgggtttcataacgtagatcat
caattacaagaaactcttatgaagaaagacatggtgagacaatga

DBGET integrated database retrieval system