KEGG   Bacillus thuringiensis YBT-1518: YBT1518_21170Help
Entry
YBT1518_21170     CDS       T02930                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bthu  Bacillus thuringiensis YBT-1518
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bthu01001]
    YBT1518_21170
Enzymes [BR:bthu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YBT1518_21170
Protein kinases [BR:bthu01001]
 Serine/threonine kinases: Other
  Bacterial family
   YBT1518_21170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AHA73362
UniProt: V5ME82
LinkDB All DBs
Position
complement(4192139..4194112)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGIIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVSDETIVLKGSKVEEPIRAEAAELDKKKKRSNKWLKVLISTFLFLAIGITLALTVI
PGLFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDIEVGDVIKTEPVAGRVV
KENAKITIYQSGGKKKSKMANFTGQNFESVKAELEEKYKQVTVNYIENDKPKGEIVEQIP
TPDQMVIEAEQELKIWVSKGPYQIRPGDFSGWTENSVTGYLNERKLTSDIKREYSDSVEK
GLVISQFPKPGTPLKEGDKVTIIISDGQKPKVTKTVKVDNISIPYEPAVTGEKKPQTIEI
YKEDMQQKMDRPVETRTITESATISLEFVIQEGSKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggtggtggc
ggaatggccaatgtatatttagctcatgatgatatacttggccgagatgtagcggtaaaa
atattaagactcgactactcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaa
gatggtatatattatcttgtcatggaatatgtacccgggcaaacattgaagcaatacata
attgagcgaggtatgttacctataggagaagctcttgatattatggagcagttaacatcc
gccatggcacacgcccatcattttgaaattgtgcatcgtgatataaagccgcacaatatt
ttaattcgagctgatggaataataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtactgggttcagtccattatttatcaccagaa
caggcacgtggcgggatagcaaataaacaatcggatatttattctcttggaatagttatg
tttgaattgttaacaggaagacaaccgttttctggcgaatctgctgttgctatagcttta
aaacatttacaaagtgaaatcccatcaccaaaaagatggaatgaaaacattccgcaaagt
gttgaaaatattatattaaaggcaactgcaaaagatcctttccatcgatatcaatctgcc
aatgctatgaagcgagatattgaaactgcgctatatccagagaggataaatgagcaacca
ttttacataccagaagatatggaagcgacgaaagcgattccgattattcaacaagaacaa
ttatttgaaaatgtaagtgatgaaacgattgttttaaaagggagtaaagtggaagaaccg
ataagagcagaagcagctgagttagataagaagaaaaaacggagtaacaagtggcttaaa
gttttaatttcaacatttttatttttagcaataggaataacattagcgcttacggttatt
ccaggattatttattccgaaagatgtgaaagttcctgatgtggctggtatgaaatacact
acagctgtaaatacgttagtagaaaagggctttgaggtgacggagcctaatattgtatat
acagatgatattgaagttggggatgtaataaaaacggaacctgtagcaggaagagtcgta
aaagaaaacgctaaaattactatctatcaatcaggtggaaaaaagaaaagtaagatggcg
aatttcacagggcaaaactttgagagtgtaaaagctgagttagaagaaaaatataaacaa
gttacagtaaattatattgaaaatgataagccgaaaggtgaaattgtagagcaaattccg
acgcctgatcaaatggttatagaagcggagcaagaactgaaaatctgggtaagtaaaggt
ccttatcaaattagaccaggtgacttttcggggtggactgaaaatagtgtaactggttat
ttgaatgagagaaaactaacgtcagatataaaacgagagtattcagattcagtcgaaaaa
ggacttgtaatttcgcaatttccaaaaccaggtacaccattaaaagagggagataaagta
actattattatctctgatggtcaaaagcctaaagtgactaaaacggtaaaagtggacaat
atctctatcccatatgagcctgctgtaacaggtgaaaaaaagccgcaaacaatagaaatt
tataaagaagatatgcagcaaaaaatggatagaccggttgaaacgagaacaattactgaa
tcagcgactatttctttagaatttgtaattcaagaaggttcaaagggacactataaaatt
gtacgagatggagtaacaattattgataaagaagtaccatatccaactcaataa

DBGET integrated database retrieval system