KEGG   Bacillus thuringiensis YBT-1518: YBT1518_24990Help
Entry
YBT1518_24990     CDS       T02930                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00020  Citrate cycle (TCA cycle)
bthu00190  Oxidative phosphorylation
bthu00650  Butanoate metabolism
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
bthu01120  Microbial metabolism in diverse environments
bthu01130  Biosynthesis of antibiotics
bthu01200  Carbon metabolism
Module
bthu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bthu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YBT1518_24990 (sdhB)
   00650 Butanoate metabolism
    YBT1518_24990 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YBT1518_24990 (sdhB)
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YBT1518_24990 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     YBT1518_24990 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AHA74116
UniProt: V5MFY7
LinkDB All DBs
Position
complement(4887711..4888472)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQEFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagatggaccagatgcacaagag
tttgaccaagagtttgaaattccatatcgtcctaatatgaatattatttcggcgcttatg
gaaattcgtcgtaatcctgttgattcaaaaggaaaccaaacaactccgatcgcatgggat
atgaactgcttagaggaagtatgcggtgcatgttcgatggttattaacggaaagccacgt
caatcatgtacggctcttattgaccaattagaacagccaattcgcttaaagccgatgaag
acattcccagttgtacgtgatttacaagttgaccgcagtcgcatgtttaatgctctaaaa
cgcgttaaagcttggattccaattgatggtacgtatgacttaggtccaggaccaagaatg
cctgagaaaaagcgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaacagtaagtctgactttattggaccagcgccgttatca
caagctcgtttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggagatggaggactagcaaactgtggtaactctcaaaactgtgtgcagtca
tgtccgaagggtattcctttaacaacttcaattgcggcattaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgataataactattaa

DBGET integrated database retrieval system