KEGG   Bacillus thuringiensis YBT-1518: YBT1518_24995Help
Entry
YBT1518_24995     CDS       T02930                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00020  Citrate cycle (TCA cycle)
bthu00190  Oxidative phosphorylation
bthu00650  Butanoate metabolism
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
bthu01120  Microbial metabolism in diverse environments
bthu01130  Biosynthesis of antibiotics
bthu01200  Carbon metabolism
Module
bthu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bthu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YBT1518_24995 (sdhA)
   00650 Butanoate metabolism
    YBT1518_24995 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YBT1518_24995 (sdhA)
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YBT1518_24995 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     YBT1518_24995 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 Not3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHA74117
UniProt: V5MGG1
LinkDB All DBs
Position
complement(4888465..4890258)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIKSFGADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTMDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMDRYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDVSLIKPRKRDYSSKHDVAAKGEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcagaagcaggagtaaatgttgaactgttttctttagtaccagtaaaacgttcacat
tctgtatgtgctcagggcggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgatttggtggaacgcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactttacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggctgggatttctta
cgagctgttgttgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattaaaagtttcggagctgatgccgtgattatggcaacagggggccctggtatc
attttcggaaaatcaacaaactccattattaatacaggtacagcagcttctgctgtatat
caacaaggtgcatattatgcaaatggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtcttatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtacttcttagaagaaaaatatccggcttacggaaac
cttgtacctcgtgatatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggggatgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggtggactatgggttgac
tataagcaaatgactagtattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgccttggtgcaaactcactattatcagcaatttacggtggtatggta
gcaggaccaaacgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtatatgagcaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
atggatggtaatgaaaatgcatatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaagttattagaaacagatgcgaaaattgaagag
ttaatggatcgttacaaacgtattaacattaacgatacagcgagatggagtaaccaaggt
gcttcatttacacgtcaacttgcaaatatgtttgagttagcacgtgttattacaattggc
gcatataaccgtaatgagagccgcggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactactatggcaaaatttgaaggagaaggaaatgcaccagca
ttccattacgaagacgttgatgtttcattaattaaaccacgtaaacgtgattattcttca
aaacatgatgtagctgctaagggtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system