KEGG   Bacillus thermoamylovorans: CQJ30_18800Help
Entry
CQJ30_18800       CDS       T06263                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bthv  Bacillus thermoamylovorans
Brite
KEGG Orthology (KO) [BR:bthv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQJ30_18800
Enzymes [BR:bthv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CQJ30_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C NAD_binding_7 NAD_binding_8 Thi4 Glutaredoxin K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AWI14024
UniProt: A0A2U8EHA4
LinkDB All DBs
Position
3949727..3951259
Genome map
AA seq 510 aa AA seqDB search
MILDADIKAQLNQYLQLMENDIIIKVSAGSDKVSGDMLALVDELATMSSKIKIEHTTLQR
TPSFSVNRVGEDTGVVFAGIPLGHEFTSLVLALLQVSGRPPKVEQKLIDQVKSLTGEYHF
ETFVSLTCHNCPEVVQALNIMSVLNPNITHTMIDGAAYKEEAESKNIMAVPTVFLNGEEF
GSGRMSLEEILVKLGKTSDPSEFMNKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQIMDTKGIENFISVKYTEGPQLAASLEEHVKEYNIDIMNLQRAKRLEKKDNLVHIEL
ENGAVLKSKTVILSTGARWRNIGVPGEEEFKTKGVAYCPHCDGPLFAGKHVAVIGGGNSG
IEAAIDLAGVVKHVTVIEFMPELKADQVLQDRLHSLSNVTVITNAQTKEITGTDKVNGLT
YIDRTTGEEHHIELAGVFVQIGLVPNTDWLEGTVERNRMGEIIVDKRGATNIPGVFAAGD
CSDSPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcggatattaaagcacaattaaatcaatatcttcagttaatggagaac
gatatcatcattaaagtaagtgcgggttctgacaaagtttcaggtgacatgctggctctt
gttgacgagctggctacgatgtcatcgaaaattaaaattgaacatactactttacaaaga
acaccaagctttagtgtgaatcgtgtgggagaagataccggagttgtttttgccggtatc
cctttaggccatgaatttacttcacttgtgcttgcgctattacaggtaagcggtcgaccg
ccaaaagttgaacaaaaactgatcgaccaagttaaaagcttaaccggtgaatatcatttt
gaaacattcgtcagcttaacttgtcataattgtcctgaagttgttcaggctctaaacatc
atgagtgtccttaacccgaatattacacatacaatgattgacggtgcggcttacaaagaa
gaagccgaaagtaaaaacattatggcggtgccgactgttttcttaaacggcgaggaattt
ggcagcggcaggatgtcactcgaagaaattctggtcaaacttgggaaaacatcggaccca
tctgagtttatgaataaagatccgtttgacgttctcgttgtcggcggtggtcctgccggt
gcgagtgccgctatttacgctgcaaggaaaggaattcgtaccggaattgtggcagaacga
ttcggcggtcaaattatggataccaagggcattgaaaactttatcagcgtaaaatacact
gagggtccgcaacttgctgccagtttagaagagcatgtaaaagaatacaatattgatata
atgaacttgcaacgggcaaaacgtttagaaaagaaagataaccttgtccatattgaattg
gaaaacggcgcagttttaaaaagtaagacagtcattctttcaaccggtgcacgttggcgc
aatataggcgtaccgggtgaagaagaattcaagacaaaaggtgttgcctattgcccgcat
tgtgacggtccgttgtttgccggaaaacatgttgcggtcatcggtggtggaaattccggg
attgaagcggcaattgatctcgcaggagttgttaaacatgtgaccgttattgaatttatg
ccggaattaaaagccgaccaagtacttcaagatcgtcttcacagtttatcaaatgtgacg
gtgattacaaacgcccaaacgaaagaaatcaccggaactgataaagtaaacgggctaact
tatattgaccggacaaccggagaagaacaccatattgagctagctggtgtctttgttcaa
atcggtcttgttcccaacaccgattggttagaaggtacggttgaacgaaatcgcatgggt
gaaattattgttgataagcgtggtgcaaccaatatcccgggtgtctttgctgccggcgac
tgtagtgatagtccatataaacaaattatcatttccatgggatccggtgcaacggcggcc
ttgggagcatttgattatttaatccgaaactaa

DBGET integrated database retrieval system