KEGG   Bacillus thuringiensis YWC2-8: AQ980_01785Help
Entry
AQ980_01785       CDS       T04752                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
bthy  Bacillus thuringiensis YWC2-8
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bthy03032]
    AQ980_01785
   03400 DNA repair and recombination proteins [BR:bthy03400]
    AQ980_01785
Enzymes [BR:bthy01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     AQ980_01785
DNA replication proteins [BR:bthy03032]
 Prokaryotic type
  DNA Topoisomerases
   AQ980_01785
DNA repair and recombination proteins [BR:bthy03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      AQ980_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C NTase_sub_bind ANTAR MnmE_helical
Motif
Other DBs
NCBI-ProteinID: ALL56626
UniProt: A0A0G3DYC9
LinkDB All DBs
Position
complement(287463..289934)
Genome map
AA seq 823 aa AA seqDB search
MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKPVHRRVLYAMNDLGIT
ADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYMLVDGHGNFGSVDGDSAA
AMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPARFPNLLVNGTTGIAVGM
ATNIPPHQLGEVIDGVLALSHNPDITIAELMEYIPGPDFPTAGLILGRSGIRRAYETGRG
SIMLRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAELVRDKKIEGITDLRDESDRN
GMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVNGEPQVLNLKQNLYHYLEHQK
VVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIRSSKTADIAKQGLMERFGLSEK
QAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAILADEEKVLEIIREELTEVKERF
NDKRRTEITIGGMEFIEDEDLIPEQNIAITLTHNGYIKRLPASTYKTQNRGGRGVQGMGT
NDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIPEYSRTAKGLPIINLLGVDKGEWIN
AIIPIREFGDDQFLFFTTKQGVSKRTPLSSFANIRTNGLIAISLREEDEVISVRLTSGDK
DIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITLGDEDQVVGMEIVEEDVNVLIVTKNGY
GKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVAVKSVTGEEDIMLITAAGVIIRMPVDQI
SQMGRNTQGVRLIRLEEDQEVATVAKAQKDEEEETSEEVSSEE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaatcaacaacaagcacgaattcgagaaattaatattagtcatgaaatgcgt
acctcatttttagattacgcaatgagtgttatcgtatctcgtgcattaccagatgttcgt
gatggattaaaacctgtgcatcgtagggttttatatgcgatgaatgatttaggaattaca
gctgataaagcgtataagaaatcagcacgtattgtcggtgaagtaatcggtaagtatcac
cctcatggtgattcagccgtttatgaaacaatggtacgtatggcgcaagattttagtcaa
cgttatatgcttgtagatgggcatggtaacttcggttctgtagatggagattcagcagct
gcaatgcgttatacagaggcaagaatgtctaagatttctatggaattaatacgtgatatt
tcaaaaaatacaattgattatcaagataactatgatggttccgaaagagaaccgatagta
ctaccagcgcgtttccctaatttattagtaaacggtacaacaggtattgctgttggtatg
gcaacaaatataccgccgcatcagcttggcgaagtaattgatggtgtgctggcattaagt
cataatcctgatattactatcgcggaattaatggaatatattcccggtccagactttccg
acggcaggtttaattttaggaagaagtggaattcgaagagcttatgaaacaggtcgcggt
tccattatgcttcgtgctaaggttgaaattgaagagaagtcaaacggtaaacaatctatt
atcgtaactgaactaccttatcaagttaataaggcacgattaattgaaaaaatcgcagaa
ttagttcgcgataagaaaattgaaggtattacagatttacgtgatgaatcagatcgtaat
ggtatgcgtattgtcatggaagtacgtcgtgatgctaatgcaaacgtactattaaacaat
ctatataaacatacagcgcttcaaacaagtttcggtattaatatgttgtctcttgtaaat
ggggagccacaagtactaaatttaaaacaaaatctatatcattatttagagcatcagaag
gtagtaattcgtagacgtactgcttatgaattagaaaaagcagaagcacgtgctcatatt
ttagaaggattacgaattgctttagatcatcttgatgaagttattacgttaattcgtagt
tcaaaaacggcagatattgccaagcaaggcttaatggaacgttttggtttaagtgagaaa
caagcgcaagcgattttagatatgcgtctgcaacgcttaactggattagaacgtgaaaaa
attgagcaagaatatcaagacttaatgaagttaattgctgaattaaaagcgattttagca
gatgaagaaaaagttcttgagattattcgtgaagaattaacagaagtaaaagagcgtttc
aatgataagagacgaacagaaattacaattggcggtatggaatttattgaagatgaagat
ttaattcctgaacaaaacattgcgattacgttaactcataacggttatattaagaggtta
ccagcttctacgtacaaaacacagaaccgtgggggacgtggtgtgcaaggaatgggtacg
aatgatgatgactttgttgaacatttattaacaacgtctactcatgatcatattttattc
tttacaaacaagggtaaagtataccgtacgaaaggatatgaaattccagagtatagtcgt
actgcaaaaggactaccaattattaacctattaggggtagataagggtgagtggattaac
gctattattccgattcgtgaatttggtgacgatcagttcttattctttacgacaaaacaa
ggggtttctaagagaacgccactttcatcatttgcaaatatacgtacaaatggtttaatt
gcaatttctcttcgtgaagaggatgaggtaatatctgtacgtttaacatcgggtgataag
gatattattgtcgggacaagtaacggtatgctaattcgtttcaatgaacaagatgttcgt
tctatgggacgtaatgctgcaggtgttaaagctattacgttgggcgatgaagaccaagtt
gtaggtatggaaattgtcgaagaggatgtaaatgttctaattgtaacgaaaaatggttac
ggaaagcgtacaccgattgatgaataccgtctgcaaagccgcggtggtaaaggtctgaaa
acttgtaacattacagataagaacggtaaattagtagctgttaaatctgttacaggtgaa
gaagatattatgttaattacagcggcaggcgttattattcgtatgccagttgatcaaatc
tctcaaatgggacgtaatacacaaggtgttcgtctaattcgattagaggaagaccaagag
gtagcgacggtagcaaaagcacaaaaagatgaagaggaagaaacgagtgaagaggtttct
tcagaagaataa

DBGET integrated database retrieval system