KEGG   Bacillus thuringiensis YWC2-8: AQ980_07760Help
Entry
AQ980_07760       CDS       T04752                                 

Definition
(GenBank) preprotein translocase subunit SecD
  KO
K12257  SecD/SecF fusion protein
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy02024  Quorum sensing
bthy03060  Protein export
bthy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    AQ980_07760
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AQ980_07760
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AQ980_07760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bthy02044]
    AQ980_07760
Secretion system [BR:bthy02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   AQ980_07760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG
Motif
Other DBs
NCBI-ProteinID: ALL57735
LinkDB All DBs
Position
1414912..1417176
Genome map
AA seq 754 aa AA seqDB search
MAKRGTRIAAFFLIVLLIGGVIGAAGKDIAKGISLGLDLRGGFEILYEVKPAKKGDKIDR
DVLVSTVGALENRVNVLGVSEPNIQIEGQDRIRVQLAGVQDQQKAREMLSTQAKLTFRDV
DDNLLMDGTDLKGGGAKQTFDEQGRASVGLTLKSAEKFREVTEKISKMPPPTNLMVIWLD
FEEGKDSYKAESAKPNPKFLSAATVNQVFNQAEVSIVGGNFTVESAKQLSSLLNAGALPV
DLKEMYSTSVGAKFGQQALEQTIFASAIGIALIFLFMLVFYRLPGLVAVIMLGLYVFVTL
LVFNWMHAVLTLPGIAALVLGVGIAVDANIITYERLKEELKIGKSMMSAFRAGNHRSLAT
ILDANVTTLAAAGVLFVYGNSSVKGFATSLIVSILVGFITNVFGTRFLLGLLVKSRYFDK
KPGYFGVKQKDIIPLTKGVVHPPTRFDRINFVNIGHKFLIFSIVVVIAGAIILPIFKLNL
GIDFASGTRIDLQSKQAVTVSDVHKDFKELNIDVKEENIVPTGDDNKGFAVRTLGVLSKD
EIAKTKTFFHDKYGTDPNISTVSPTIGKEIARNAFIAVLIASAVIILYVSIRFRFTYALS
AVLALLHDAFVMVVMFSIFQLEVDLTFIAAVLTIIGYSINDSIVTFDRNRELYKQKKRVR
DIKDLEEIVNASIRQTLGRSINTVLTVLFPVIALLIFGSESLRNFSFALLVGLIVGTYSS
VFVASQIWLMLENRRLKKGKNKKKVEKVESEPQV
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgtggtacgagaattgccgcctttttcctcatcgttttattaatcggtgga
gtaattggtgcggcaggaaaagacatagcaaaaggaattagtctaggactagaccttcgc
ggtggttttgaaattctgtatgaagtaaaaccagccaaaaaaggggacaaaatcgatcga
gacgtacttgtaagtacagtaggtgctcttgagaatcgtgtcaatgttctcggtgtaagt
gagccgaacattcaaatcgaagggcaagatcgaattcgtgtacagcttgctggtgtacaa
gatcagcaaaaagcacgtgaaatgttatcaacacaagcgaaattaacattccgtgatgta
gatgataatcttcttatggacggaacggatttaaaaggcggcggagcgaagcaaacattt
gatgagcaaggccgtgcgagcgtaggtcttacactaaagagcgctgaaaaattccgtgaa
gtaactgaaaaaatttcaaaaatgccaccaccaacgaatttaatggtaatttggcttgat
tttgaagaaggaaaagattcgtacaaagcagaatctgcaaaaccgaatccgaagttctta
tcagcagcaacagtaaaccaagtatttaaccaagctgaagtatctatcgtaggtggaaac
ttcacagttgaaagtgcgaaacaactttcatctttattaaatgcaggtgcacttcctgtt
gatttaaaagaaatgtattcaacatctgttggagcgaagtttggtcaacaagcgttagag
caaacgattttcgctagtgcgattggtatcgctcttattttcttatttatgcttgtattc
taccgtttaccaggacttgtagcggttattatgttaggtttatacgttttcgttacatta
cttgtctttaactggatgcatgcagttcttacgttgccaggtattgcggcgttagtgctc
ggagtaggtatcgcagttgatgcgaatattattacgtacgagagactgaaagaagagttg
aaaattggtaagtccatgatgtcggcattccgcgctggtaaccatcgttcattagcaaca
attctagatgcaaacgttacaactcttgcggcagctggtgtgttattcgtttatggtaat
agctctgtaaaaggattcgcaacaagtttaatcgtaagtattttagttggttttattacg
aacgtattcggtactcgtttcttactaggtttacttgtaaagagccgttactttgataaa
aaaccaggatattttggtgtgaaacaaaaggatattattccattaacaaaaggtgtagta
catccgccaacgagatttgatcgtattaacttcgtaaatatcggtcataaattccttatc
ttctcgattgtagttgtaattgcgggtgcaattatcttaccaattttcaaattgaatctt
ggtattgactttgcaagtggtacacgtattgacttgcaatcaaaacaagccgttacggtg
tctgatgttcataaagattttaaagaactgaacattgatgtgaaggaagaaaatattgta
ccgactggagatgacaataaaggtttcgcagttcgtacattaggtgttttatcaaaagat
gaaattgcgaaaacaaaaacattcttccacgataaatatggtacagatccaaacataagt
acagtttcaccgacaatcggtaaagaaattgcacgaaatgcatttatcgctgtactgatt
gcttctgcggttatcattttatacgtaagtattcgattccgatttacgtatgcgttatct
gcagtacttgcattattacatgacgctttcgttatggttgttatgtttagtattttccaa
ctagaggtagacttaacgtttatcgctgcagtactaacaatcatcggttattctattaat
gactcgattgttacatttgatagaaaccgtgaattatacaaacagaaaaaacgagtgcgc
gatataaaagatctagaagaaatcgtaaatgcaagtattcgccaaacgcttggtcgctcg
attaataccgtattaacagtgttattcccagtaattgcactgcttatcttcggtagtgag
tcactacgtaacttctcgtttgcgttacttgttggattaattgtaggtacgtactcttct
gttttcgttgcctctcaaatttggttaatgcttgaaaaccgtcgtttgaaaaagggaaaa
aacaagaagaaggttgagaaagtagaatctgaaccgcaagtatag

DBGET integrated database retrieval system