KEGG   Bacillus thuringiensis YWC2-8: AQ980_10605Help
Entry
AQ980_10605       CDS       T04752                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bthy  Bacillus thuringiensis YWC2-8
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bthy01001]
    AQ980_10605
Enzymes [BR:bthy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AQ980_10605
Protein kinases [BR:bthy01001]
 Serine/threonine kinases: Other
  Bacterial family
   AQ980_10605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ALL58277
UniProt: A0A1B1SUU9
LinkDB All DBs
Position
1933938..1935911
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGIIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVSDETIVLKGSKVEEPIRAEAAELDKKKKRSNKWLKVLISTFLFLAIGITLALTVI
PGLFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNIVYTDDVEVGDVIKTDPVAGRVV
KENAKITIYQSGGKKKSKMANFTGQNFESVKAELEEKYKQVTVNYIENDKPKGEIVEQIP
TPDQMVIEAEQELKIWVSKGPYQIRPGDFSGWTENSVTGYLNERKLTSDIKREYSDTVEK
GLVISQFPKPGTPLKEGDKVTIIISDGQKPKVTKTVKVDNISIPYEPAVTGEKKPQTIEI
YKEDMQQKMDRPVETRTITESATISLEFVIQEGSKGHYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggtggtggc
ggaatggccaatgtatatttagctcatgatgatatacttggccgagatgtagcggtaaaa
atattaagactcgactactcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaa
gatggtatatactatcttgtcatggaatatgtaccagggcaaacattgaagcaatacata
attgagcgagggatgttacctataggagaagctcttgatattatggagcagttaacatcc
gctatggcacatgcccatcattttgaaattgtgcatcgtgatataaagccgcacaatatt
ttaattcgagctgatggaataataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtgcttggttcagtccattatttatcaccagaa
caggcacgtggcgggatagcaaataaacaatcagatatctattctcttggaatagttatg
tttgaattgttaacaggaagacaaccgttttctggcgaatctgctgttgctatagcttta
aaacatttacaaagtgaaatcccatcaccaaaaagatggaatgaaaatattccgcaaagt
gttgaaaatattatattaaaggcaactgcaaaagatccgtttcaccgatatcaatctgcc
aatgcgatgaagcgagatattgaaactgcgctatatccagagaggataaatgagcaacca
ttttacataccggaagatatggaagcgacgaaagcgattccgattattcaacaagaacaa
ttatttgaaaatgtaagtgatgaaacgattgttttaaaagggagtaaggtggaagaaccg
ataagagcagaagcagctgagttagataagaagaaaaaacggagtaacaagtggcttaaa
gttttaatttcaacatttttatttttagcaataggaataacattagcacttacggttatt
ccaggattatttattccgaaagatgtgaaagttcctgatgtggctggtatgaaatacacg
acagctgtaaatacattagtagaaaagggctttgaggtgacggagcctaatattgtatat
acagatgatgttgaagttggggatgtaataaaaacggaccctgtagcaggaagagtcgta
aaagaaaacgctaaaattactatctatcaatcaggtggaaaaaagaaaagtaagatggca
aatttcacaggtcaaaactttgagagtgtaaaagctgagttagaagaaaaatataaacaa
gttacggtaaattatattgaaaatgataagccgaaaggtgaaattgtagaacaaattccg
acgcctgatcagatggttatagaagcggagcaagaactgaaaatctgggtaagtaaaggg
ccttatcaaattagaccaggtgacttttcggggtggactgaaaatagtgtaactggttat
ttgaatgagagaaaactaacgtcagatataaaacgagagtattcagatacagtcgaaaaa
ggacttgtaatttcgcaatttccaaaaccaggtacaccattaaaagagggagataaagta
actattattatctctgatggtcaaaagcctaaagtgactaaaacggtaaaagtggacaat
atctctatcccatatgagcctgctgtaacaggtgaaaaaaagccgcaaacaatagaaatt
tataaagaagacatgcagcaaaaaatggatagaccggttgaaacgagaacaattactgaa
tcagcgactatttctttagaatttgtaattcaagaaggttcaaagggacactataaaatt
gtacgggatggagtaacgattattgataaagaagtaccatatccaactcaataa

DBGET integrated database retrieval system