KEGG   Bacillus thuringiensis YWC2-8: AQ980_12680Help
Entry
AQ980_12680       CDS       T04752                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00500  Starch and sucrose metabolism
bthy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AQ980_12680
Enzymes [BR:bthy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AQ980_12680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ALL58670
UniProt: A0A243H5L3
LinkDB All DBs
Position
2374854..2376395
Genome map
AA seq 513 aa AA seqDB search
MFKRITIVGLSVVMFLPSIYDGSKAYADTVNNGTLMQYFEWYAPNDGNHWNRLRTDAENL
AKKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHK
KNIDVYGDVVMNHKGGADYTETVTAVEVDPSNRNIEVSGDYEISAWTGFNFPGRGDSYSN
FKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVAN
EMKKWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTL
NNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQ
PGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTA
RKNFAYGTQRDYFDHPDVIGWTREGDSVHANSGLATLISDGPGGAKWMDVGKNNAGEVWY
DITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaataacaatagtcggattgtcagttgttatgtttttacctagtatatat
gacgggagtaaagcatatgcagacacagttaacaatggaacgttaatgcagtattttgag
tggtatgctccgaatgatgggaatcattggaatcgtttgcgtactgatgctgaaaattta
gcgaaaaaaggaattacatctgtttggataccacctgcatataaaggaactacgcaaaat
gacgtaggatatggagcatatgatttatatgatctgggggaattcaatcaaaagggaaca
gtgcggacgaagtatgggacgaaagcacaattgaaatctgcaattgacgctttacataag
aaaaacatcgatgtatacggtgatgtagttatgaatcataaaggtggggctgattataca
gaaactgtcacagcagttgaggtagacccgagcaatcggaatattgaagtatcaggtgat
tatgaaattagtgcgtggacgggatttaactttccagggcgtggagattcttattctaat
ttcaaatggaaatggtatcattttgacggaacggattgggatgaaggaaggaaattaaac
cgaatttataaatttaggggcataggtaaagcatgggactgggaagtgtctagcgagaat
gggaattatgattatttgatgtatgcggatcttgattttgatcatccagatgttgcgaat
gaaatgaaaaaatggggaacgtggtatgcgaatgaattaaatttagatggttttcgttta
gatgctgttaaacatattgatcatgaatatttgcgcgattgggtaaatcacgttagacag
caaacagggaaagaaatgtttacagtagctgaatattggcaaaatgatatccagacttta
aataattatttagcgaaggttaattataatcaatctgtgttcgatgcaccacttcattat
aattttcattatgcttcaacaggaaatggaaattatgatatgagaaatattttaaaagga
acggtagttgcgaatcatcctacacttgcggttactctagttgaaaatcatgattcacag
cctggtcagtcattggaatctgtagtgagcccttggttcaagccgctggcatatgcattt
attttaacgcgtgcagaggggtatccttctgttttctatggtgattactatggtacaaaa
ggaaatagtaactatgaaattccagcgttaaaggacaaaattgatccgattttgacggca
cgaaaaaactttgcatatggtacgcagcgtgattattttgatcatccagatgtgattggc
tggacaagagaaggtgatagtgtacatgctaattctggtttagcaacattaatctctgat
ggaccaggaggggcaaagtggatggatgttggaaagaataacgcaggggaagtatggtac
gatattacgggtaatcaaacgaatactgtaacaattaataaggacggatgggggcagttt
caagtaagtggaggatcagtttccatatatgttcagcagtaa

DBGET integrated database retrieval system