KEGG   Bacillus thuringiensis YWC2-8: AQ980_13760Help
Entry
AQ980_13760       CDS       T04752                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00250  Alanine, aspartate and glutamate metabolism
bthy00410  beta-Alanine metabolism
bthy00430  Taurine and hypotaurine metabolism
bthy00650  Butanoate metabolism
bthy01100  Metabolic pathways
bthy01110  Biosynthesis of secondary metabolites
bthy01120  Microbial metabolism in diverse environments
bthy02024  Quorum sensing
Module
bthy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AQ980_13760
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AQ980_13760
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AQ980_13760
   00430 Taurine and hypotaurine metabolism
    AQ980_13760
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AQ980_13760
Enzymes [BR:bthy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AQ980_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALL58872
UniProt: A0A2C9Z1L8
LinkDB All DBs
Position
2577754..2579223
Genome map
AA seq 489 aa AA seqDB search
MPQDRKEEVQNDTYEGKEVMPDNPQYLPRHVQMELPPEFSINPLFARKGESVVPRFHMPD
EGMLPETAYQIVHDEMTLDGNARLNLATFVSTWMEPTAEHLYAKSFDKNMIDKDEYPQTA
EIEERCVRILANLWHSPSPLTTMGVSTTGSSEACMLGGLALKRRWQNARKREGKPVDRPN
IVFSSAVQVVWEKFANYWEVEPRYVKVSPEHPRLNPQGVLAAVDENTIGVVPILGETYTG
LYEPVAAIAKALDDLQERTGLDIPMHVDAASGGFIAPFLQPDLVWDFQLPRVKSINVSGH
KYGLVYPGLGWIIWREADDLPDDLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNYLRLG
KSGYYDVQRASQKVALFLSKAIQEMEPFELLSDGSDIPVFAWQLKKGYTLNWNLYDLSRQ
LRVFGWQVPAYPLPPDLEAVTIMRVVVRNGFSMDLAHLFLRNLKQAVAFLDSLDGPMPHD
TKCDNGFHH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggatcgaaaagaagaagtgcaaaacgatacatatgaaggaaaagaggttatg
ccagataatccacaatatctaccgcgtcacgtgcaaatggagctgcctcccgaattttct
ataaatcctctttttgcccgcaaaggagaatcagtcgttccgcgctttcacatgcctgat
gaaggcatgttaccagaaacagcgtatcaaatcgtccatgatgaaatgactcttgatggc
aatgcacgtttgaatcttgcaacattcgttagtacatggatggaacctaccgcagagcac
ttatatgctaaatcatttgataagaacatgattgataaggacgaatatccacagacagct
gaaattgaggagcggtgtgtccgcattttagccaacctctggcattcccccagccccctt
acaactatgggcgtttcaacaactggatcgtcggaagcctgtatgctcggggggcttgcg
ttaaagagacgctggcaaaatgcacgaaaaagagagggtaagccggtggatcggcctaat
attgtgtttagttctgctgttcaagtcgtttgggaaaaatttgcgaactattgggaggtt
gaaccacgctatgtgaaggttagccctgagcatccccgattaaatcctcaaggggtcctt
gcagccgtggatgaaaatacgattggtgtggtaccgattctcggtgagacttataccgga
ctttacgaaccggttgccgccattgcaaaagcgttggacgatttacaggagagaacggga
ctggacattcctatgcatgtagatgcggcttcgggcggatttatagcaccgtttcttcaa
ccagatttagtctgggattttcagttgccgagggtgaagtccatcaatgtatccggacat
aaatatggattagtctaccctggcttgggttggataatttggcgggaagctgatgatctc
cctgatgatttaatcttccgcgtctcctatttaggcgggaacatgccgacttttgccttg
aatttttcacgtcctggcgcacaagtgcttctacaatattacaattacctgcgtttgggg
aaaagtgggtactatgatgtccaaagggcttctcaaaaggtcgctctttttcttagcaag
gcaattcaggagatggaaccattcgaacttttgtccgatggttcggatattccggttttc
gcttggcaactgaaaaaaggttacacattaaactggaacctttatgatttatctcgacaa
ttgcgtgtgttcggctggcaagtacccgcatatccattgcctccagacctagaagcagtg
acaattatgcgcgttgtggttcgaaacgggttttctatggatctcgcgcatttatttttg
aggaacctcaaacaggccgttgcctttctggattccttggatggacctatgccacatgat
acgaaatgtgataatgggtttcatcactaa

DBGET integrated database retrieval system