KEGG   Bacillus thuringiensis YWC2-8: AQ980_15680Help
Entry
AQ980_15680       CDS       T04752                                 

Definition
(GenBank) MFS transporter
Organism
bthy  Bacillus thuringiensis YWC2-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_1_like Sugar_tr OATP DUF1648
Motif
Other DBs
NCBI-ProteinID: ALL59223
UniProt: A0A231HW14
LinkDB All DBs
Position
2960480..2961694
Genome map
AA seq 404 aa AA seqDB search
MNYLLLRYNKPIFIRLCGELLTRTTESMLALIMIIYVNKMLNGNVIITMLIFGLQPLSDI
LFTLIAGGITDKYGRKKIMLLGLLLQGVAIGSFVFAQSVFIFALLYVINGIGRSLYIPAQ
RAQIADLTKQEQQAEIFALLQTMGAIGSVIGPLIGACFYNTHPEYLFIVQSVTLTIYAVV
VWTQLPETVPPMSKSKQTVEASSPKQFIFKHYAIFGLMVSTLPISFFYAQTETNYRIFAE
HVFPNLLFILAFISTCKAILEIILQIFLVKWSERFSMAKIILISYACYTIAAVGFSSSTT
ILSLFFTLLFLVIGESIALNHLLRFVSEIAPHNKRGLYFSIYGIHWDISRTCGPVMGAVL
LSKLNGSMLFYICASFLLIGGIVQALFVQNLERKKIMNQPTHNL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatctcttacttcgttacaataaacctatttttattagattgtgtggtgaatta
ttaacccgaacgactgaatctatgttagctctcattatgattatttacgtcaataaaatg
ttaaacggcaatgtaataataactatgctaattttcggattacagccactttcagacatt
ttatttacacttattgctggaggaattactgataaatatggccgaaaaaagattatgtta
ctcggattattactacaaggtgttgcaatcggcagtttcgttttcgctcaatctgttttt
atatttgcactgttatatgtcattaatggtattggccgttccttatacattccagctcag
cgtgcacaaattgctgatttaacaaaacaagagcagcaagcagaaatttttgctctccta
caaacgatgggagcaattggatccgtaatcggccctttaatcggtgcatgtttttataat
actcacccagaatatttatttatcgtgcaaagtgtaacccttacgatatatgccgttgtt
gtttggacccagctcccagaaaccgttccacctatgagtaagtcgaaacaaacagttgag
gcaagttcaccaaagcaatttatttttaaacattatgccatattcggtcttatggtttct
acacttcctattagctttttttatgcacaaactgagacgaattatcgtatttttgcagaa
catgtatttcctaatctcttattcatactcgcatttatttcaacatgcaaagccattttg
gaaatcatactacaaatcttcctcgtaaaatggtctgaacgattttctatggcgaaaatc
atccttatttcttacgcctgctatacaatagctgcagttggctttagttcttcaacgacg
atattgtcgttattcttcaccttactctttttagtcattggagaaagtattgctctaaac
cacttattacgattcgtttcagaaattgcacctcacaataaacgtggtttatatttttca
atttacggtatacactgggatatatctcgaacgtgcggaccagttatgggtgcagtttta
ttaagtaagttaaatggaagtatgctgttttatatttgtgctagtttcttattaattgga
ggtattgttcaagcactgtttgttcaaaatttagaacgtaaaaaaatcatgaaccagcct
acacataatttatag

DBGET integrated database retrieval system