KEGG   Bacillus thuringiensis YWC2-8: AQ980_16170Help
Entry
AQ980_16170       CDS       T04752                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00330  Arginine and proline metabolism
bthy01100  Metabolic pathways
bthy01110  Biosynthesis of secondary metabolites
bthy01130  Biosynthesis of antibiotics
bthy01230  Biosynthesis of amino acids
Module
bthy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AQ980_16170
Enzymes [BR:bthy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AQ980_16170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 PDH IlvN NAD_Gly3P_dh_N SIS_2 3HCDH_N 2-Hacid_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ALL59316
UniProt: A0A1B1SXB9
LinkDB All DBs
Position
3052506..3053324
Genome map
AA seq 272 aa AA seqDB search
MDKQIGFIGCGNMGMAMIGGMINKNIVSSNQIICSDLNTANLKNASEKYGLTTTTDNNKV
AKNADILILSIKPDLYSSIINEIKEVIKNDAIIVTIAAGKSIESTENAFNKKVKVVRVMP
NTPALVGEGMSALCPNEMVTEKDLEDVLNIFNSFGQTEIVSEKLMDVVTSVSGSSPAYVY
MIIEAMADAAVLDGMPRNQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTTIEAV
ATLEEKGLRTAIISAMQRCTQKSVELSGQTKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaaattggattcatcggttgcggaaatatgggaatggctatgattggcgga
atgataaacaaaaatatagtatcttcaaatcaaattatttgttcagatttaaacactgct
aatttaaaaaatgctagtgaaaaatatgggctaactacaactaccgacaacaataaagta
gctaaaaatgctgatattttaattttatcaatcaaaccagacctatattcatcaataatt
aatgaaataaaagaagtaatcaaaaacgatgctatcatcgttacgatcgctgctggaaaa
agtattgaaagtactgaaaatgcctttaataaaaaagtaaaggttgtaagagtaatgcct
aatactcctgctcttgttggagaaggaatgtctgcattatgccctaatgaaatggtgaca
gaaaaagatttagaagatgtactaaacattttcaatagttttggtcaaacagagatcgta
agtgaaaaattaatggatgttgtcacatccgtaagtggttcttcaccagcttatgtatat
atgattatagaagcgatggcagatgctgctgtactagatggtatgccaagaaatcaagca
tataaattcgctgctcaagctgtgttaggctctgcaaaaatggtactagaaacaggaata
catccaggtgaattgaaagatatggtttgttctcctggcggaacgacaatagaagctgta
gcaacattagaggaaaaaggattacgaacagcgattatttcagctatgcagcgttgtacg
caaaagtctgttgaactatctggtcaaactaaaaaataa

DBGET integrated database retrieval system