KEGG   Bacillus thuringiensis YWC2-8: AQ980_22730Help
Entry
AQ980_22730       CDS       T04752                                 

Definition
(GenBank) hydroxyacid dehydrogenase
Organism
bthy  Bacillus thuringiensis YWC2-8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD NAD_binding_2 IlvN F420_oxidored Shikimate_DH XdhC_C
Motif
Other DBs
NCBI-ProteinID: ALL60543
LinkDB All DBs
Position
complement(4381532..4382503)
Genome map
AA seq 323 aa AA seqDB search
MAKILVAGKIPEIGLELLKDHDVEMYDKEELISIDELTERVKDKDALLSLLSTKVPKEVI
DAAPHLKIVANYGAGYDNIDYKYAGEKGIAVTNTPKVSTEATAELTFALLLAAARRIPEG
DTLCRTTGFNGWAPLFFLGREVHGKTIGIIGLGEIGKAVAKRAKAFGMDVLYTGPNRKLE
AESELGATYVMLEELLQTADFITINCAYSPNLHHMIDEEQFKMMKKTAYIVNASRGPIMN
EAALAHALKTNEIEGAALDVFEFEPKITEELKELKNVVLAPHVGNATFETRDAMAEMAVR
NILAVLNGEEPVTPVNQKVLVTK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaatattagtagcgggaaaaattccggaaattggattagaactattaaaagat
catgatgtagaaatgtacgataaagaggagttaatttctatagatgaattaacagagcgt
gtaaaagataaagatgcattgttaagtttactttcgacaaaggtgccaaaagaagttatt
gatgcagcgcctcatttaaagattgttgcaaactatggtgctggttacgacaatattgat
tacaagtatgcgggcgaaaaaggaattgcagttacgaatacaccgaaagtatcaacggaa
gcgactgcagaattaacatttgcacttcttttagcagcggcgcgtagaattcctgaaggg
gatacgttatgtcgtacgactggatttaacggatgggcaccgttatttttcttaggacga
gaagttcatggtaagacaatcggaattataggtcttggagaaatcgggaaggctgttgca
aaacgtgcgaaagcatttggaatggatgttttatatacagggccaaatcgtaagcttgaa
gctgaaagtgagctgggggcaacgtatgtgatgttggaagaattattacaaacagcagac
tttattacaattaactgtgcttatagtccaaatttacatcatatgattgatgaagagcag
tttaaaatgatgaagaaaacagcgtatattgtaaatgcttcacgtggaccaattatgaat
gaagcagcacttgctcatgcattaaaaacgaatgaaattgaaggagcagctcttgacgtg
tttgaatttgaaccgaaaattacagaagagctaaaagaattaaagaatgtagtacttgct
ccacacgtagggaatgcaacatttgaaactcgtgatgcgatggctgaaatggctgtcaga
aatattttagctgtattaaacggcgaagagccagtaacacctgtaaatcaaaaggtatta
gttacaaaataa

DBGET integrated database retrieval system