KEGG   Bacillus thuringiensis YWC2-8: AQ980_27615Help
Entry
AQ980_27615       CDS       T04752                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bthy  Bacillus thuringiensis YWC2-8
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bthy01002]
    AQ980_27615
Enzymes [BR:bthy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     AQ980_27615
Peptidases [BR:bthy01002]
 Metallo Peptidases
  Family M4: thermolysin family
   AQ980_27615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ALL61464
UniProt: O32309
LinkDB All DBs
Position
complement(5267863..5269563)
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKFNTIDHVTNDDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGITYDYYKNTFNRNSINDAGAPLKSTVHYGSNY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSNLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVNGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVAAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagagtttagcattagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcgtttgcggattctaaaaatgtgctctctactaagaagtacaatgag
acggtgcagtcacctgagtttatttctggtgatctaactgaagcaactggcaagaaagca
gaatctgttgtgtttgattacttaaacgcagcaaaaggtgattacaagctaggggaaaag
agtgcacaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtgcctgtatggggttctactcaagtagct
cacgtaagtaaggacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaagtagaaccaaaagcggacttatatgta
tatcaaaacggtgaggaaacaacatatgcatatgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaggcagacagcggtaaagtattaaataagttt
aatacaattgatcatgtgacgaatgatgataagtcaccagttaagcaagaggctcctaaa
caggatgcgaaagctgttgtaaagcctgtaacaggaacgaataaagtaggaactggtaaa
ggcgtactaggagatacgaagtctcttaatacaacgttatctggatcatcttactactta
caagataatacacgcggggcaacgattttcacatatgatgcgaaaaaccgttcaacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcagcg
gtagatgctcattactatgcgggtatcacgtatgattactataagaatacatttaatcgt
aattcaattaatgatgcaggagcgccgttaaaatcaacagttcattacggaagtaattat
aacaatgcattctggaacggatcacagatggtatacggagatggtgatggtgtaacattt
acttcattatctggtggaattgatgtaattggtcacgagttaacgcatgctgttacggaa
aatagttcaaatctaatttatcaaaatgaatcaggggctttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccggattgggagattggtgaa
gatatttacacacctggtaaagcaggagacgcgcttcgctctatgagtgatcctacgaag
tatggtgatccagaccattattctaagcgttacactggttcaagtgataacggtggcgtt
catacaaacagcggcattattaataaacaagcttatttattagcaaatggcggtacgcat
tacggtgtaactgtaaatggtatcggcaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgcagcagacttatatggtgcaaattctgctgaagtagcagcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system