KEGG   Bacillus thuringiensis YWC2-8: AQ980_29250Help
Entry
AQ980_29250       CDS       T04752                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bthy  Bacillus thuringiensis YWC2-8
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AQ980_29250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE CBP_BcsG
Motif
Other DBs
NCBI-ProteinID: ALL61759
UniProt: A0A1B1T419
LinkDB All DBs
Position
complement(5589668..5590438)
Genome map
AA seq 256 aa AA seqDB search
MEELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLSPASAIATNKLAATMGTF
TSAMYFIRSGKVDFKIVGKLIPLTIVGAVAGALVVKFIPSDILRPLVLVMLVFIAIYIIA
KKNWGSVSTYKKMTQRKTLIFFFAILMIGFYDGFFGPGTGSFLIFAFLLIGLDFIQAAAS
GKLLNFVSNIVSLITFLFLDIIHFEYGIIMGLSMILGAYFGSKFAVQKGVGYVRTLFLLV
TILLIGKNVLEYTHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattaagttttcaagtcattattttattaattgcattcggttttttagcagct
tttattgattccgttgttggaggaggagggttaatttcgcttcctgcacttatgtttgtt
ggcctatcgccagcttcggcaattgcaacgaataaattagcggcaacaatggggacgttt
acgagtgcgatgtatttcattcgatcaggaaaagttgattttaaaattgtaggaaagtta
atcccgttaactattgttggagctgttgcaggtgctttagtagtaaaatttattccatcg
gatattttacgcccattagtacttgtaatgttggtatttattgctatttatattattgca
aaaaagaattggggaagtgtgtctacctataagaagatgacgcaaagaaaaacattaata
tttttctttgctattttaatgataggattttatgatgggttttttggaccagggacaggg
tcgtttttaatttttgcatttttattaattggcttggattttattcaagcggcagcatct
ggaaaacttttgaactttgttagtaatattgtatctttaattacttttttattcttagac
ataattcattttgaatacggtattatcatgggattatcaatgatcttaggtgcttatttt
ggatcgaagtttgcggttcaaaaaggtgttggatatgtaaggactttatttttattagtt
actatattattgatcgggaaaaatgttttggaatatactcatattttgtag

DBGET integrated database retrieval system