KEGG   Bacillus thuringiensis HD-771: BTG_09600Help
Entry
BTG_09600         CDS       T02293                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00473  D-Alanine metabolism
bti01100  Metabolic pathways
bti01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTG_09600
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BTG_09600
Enzymes [BR:bti01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTG_09600
Peptidoglycan biosynthesis and degradation proteins [BR:bti01011]
 Precursor biosynthesis
  Racemase
   BTG_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFQ15386
UniProt: J3UM40
LinkDB All DBs
Position
complement(1875782..1876957)
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVNEFKKHVNDEKIKMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTARELGIQIPYIHSSNSAGSIELSNTFQNMVRVGIGVYGMYPSKEVDH
TIVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGIRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaacgaatttaaaaaacatgtaaatgatgaaaaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagcagga
ataaatcaacttgcagttgcatttgtagatgaagcgatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagttgcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaggttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgagagaattaggaattcaa
ataccatatattcatagttcaaatagtgcaggatcaatagaattaagtaacacatttcaa
aatatggtacgcgttggaataggagtatacggtatgtatccgtcaaaagaagtggatcat
acaatcgtttctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacat
gcgaagaagaatcgcggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacgggattcgagtacctgttatcggccgtgtttgtatggatcagtta
atgctggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system