KEGG   Bacillus thuringiensis HD-771: BTG_09660Help
Entry
BTG_09660         CDS       T02293                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bti  Bacillus thuringiensis HD-771
Brite
KEGG Orthology (KO) [BR:bti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTG_09660
Enzymes [BR:bti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTG_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VanY DUF1244 Peptidase_M15_4 FeoB_associated
Motif
Other DBs
NCBI-ProteinID: AFQ15398
UniProt: J3U2S3
LinkDB All DBs
Position
complement(1887429..1888169)
Genome map
AA seq 246 aa AA seqDB search
MKKRWALLGIIAAIIIVGVAGINYKMYKDKQAREVSVNSIFPKAKETIANMDGDIAVINN
PNSMLVLVNKSRRLPDGYRPPDLVIPKVRYSSEGDQEKKKMRKEAARALEDMFQQADNER
IFLFAVSGFRSFDRQKALNTMYKKQDGEAKTAMSSAVPGTSEHQTGLAMDITSQSAKFQL
ETVFGETKEGQWLSENAHKFGFVIRYTKAKETITGYRYEPWHVRYVGNPQATYLYDNQLT
LEEVTE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagatgggcactacttggtatcatagctgcaataattattgttggagtagca
ggaatcaattataaaatgtataaggataagcaggcgcgggaagtaagtgtaaatagcata
tttccgaaagcaaaagaaacgattgctaatatggatggggatattgcggtaattaataat
ccgaattcaatgcttgtacttgtgaataaaagtaggcgtttaccagatgggtatagaccg
ccagatttagttattccgaaagtgcgctactctagtgaaggtgatcaagaaaagaaaaag
atgagaaaagaggcagcgagggcgcttgaggatatgtttcagcaggctgacaacgagcgt
attttcctgtttgcagtttctggatttagatcttttgatcgacaaaaagcattaaatacg
atgtataaaaaacaagatggagaagcaaaaacagcaatgtctagcgcggttcctggtaca
agtgagcatcaaactggactagctatggatattacgtctcaatctgctaaatttcagtta
gagacggtttttggggaaacgaaagaaggtcagtggctttctgaaaatgcccataaattt
ggttttgtgattcgatacacaaaagcgaaagagacgattacgggatatcggtatgaacca
tggcacgtaaggtatgtgggaaatccacaagctacatatttgtatgataatcaactgacg
cttgaagaagtaacagagtga

DBGET integrated database retrieval system