KEGG   Bacillus thuringiensis HD-771: BTG_13715Help
Entry
BTG_13715         CDS       T02293                                 

Gene name
hisG
Definition
(GenBank) ATP phosphoribosyltransferase catalytic subunit
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00340  Histidine metabolism
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01230  Biosynthesis of amino acids
Module
bti_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BTG_13715 (hisG)
Enzymes [BR:bti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     BTG_13715 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-ProteinID: AFQ16195
UniProt: J3ZXX7
LinkDB All DBs
Position
complement(2684280..2684915)
Genome map
AA seq 211 aa AA seqDB search
MRNIQIALTKGRLEKHVIPLFEQIGIDCSELKNKGRKLVFQSKNTNVSFILVKAVDVATY
VEHGVADIGIVGKDILMENEKDIYEMLDLGVGICKFCVASIPTYNPKSYRKKRIATKYPH
ITSTYFHDKGEDVEIIKIEGSVEIAPLLGLADAIVDIVETGKTLQENGLIIFEEMQSISA
RMIVNKAALKTKKDEIFSIVNMMEQEILSGK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacattcaaattgcgttaacgaaaggaagattagaaaaacatgtaattccactc
tttgagcagattggaattgattgttcggaactcaaaaataaaggtcgaaagcttgtattt
caaagtaaaaatacaaatgtttcatttattttagtaaaagcggttgatgttgctacttat
gtagaacatggggtagctgatattgggatcgttggaaaagatattttaatggaaaacgag
aaagatatttatgaaatgctggatttaggagtagggatttgtaagttttgtgttgcttct
attcctacgtataatccgaaaagttaccggaagaaaagaattgctacgaaatacccacat
attacttctacttattttcatgataagggagaggacgtagaaattattaaaatagaaggt
tctgtagaaatcgctcctcttcttggattggcagatgcaattgtagatattgttgaaaca
ggaaaaacattacaagagaatggacttattatatttgaggaaatgcaatctatatcggct
cggatgattgtaaataaggcggccttaaaaactaaaaaagacgaaatattcagtattgta
aatatgatggagcaagaaatcttatcagggaaatag

DBGET integrated database retrieval system