KEGG   Bacillus thuringiensis HD-771: BTG_14670
Entry
BTG_14670         CDS       T02293                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00521  Streptomycin biosynthesis
bti00523  Polyketide sugar unit biosynthesis
bti00525  Acarbose and validamycin biosynthesis
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
Module
bti_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BTG_14670
   01055 Biosynthesis of vancomycin group antibiotics
    BTG_14670
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BTG_14670
   00525 Acarbose and validamycin biosynthesis
    BTG_14670
Enzymes [BR:bti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BTG_14670
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_4 NmrA NAD_binding_10 HIGH_NTase1_ass Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AFQ16386
UniProt: J3UNZ3
LinkDB
Position
complement(2859849..2860820)
AA seq 323 aa
MNILVTGGAGFIGSNFVHYMLQSYETYKIINYDALTYSGNLNNVKSLQNHPNYSFVKGEI
QNGELLEHIIKERDVQVIVNFAAESHVDRSIENPIPFYDTNVIGTVTLLELVKKYSHIKL
VQVSTDEVYGSLGKIGKFTEKTPLAPNSPYSSSKASADLIALSYYKTYHLPVIVTRCSNN
YGPYQYPEKLIPLMVTNALEGKKLPLYGDGLNVRDWLHVTDHCSAIDVVLHKGRVGEVYN
IGGNNEKTNVEVVEQIITLLGKTKKDIEYVTDRLGHDRRYAIDAEKMKNEFDWEPKYTFE
QGLQETVKWYEKNKEWWKLLKDQ
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaatatattagtaacaggtggggctggatttattggaagtaatttcgttcattatatg
ctacaaagttatgaaacatataaaattattaattacgatgcattaacatatagcgggaat
ttaaataacgtaaaatctcttcagaatcacccgaattactcttttgtaaaaggagaaatt
caaaatggagagctattagaacatattataaaagagcgagacgtacaagtgattgtaaat
tttgcagctgaatcacatgtggaccgtagtattgaaaatccgattcctttttatgataca
aatgtaattgggacggtcactttattagaactagttaaaaaatattcgcatataaaactt
gtgcaagtatcaacggatgaagtgtatggctctttagggaaaatagggaaattcacagag
aaaacgccgttagctccaaatagtccatattcttcaagtaaggcgagcgcggacctgata
gctctatcttactataaaacatatcacttaccggttatagtaacgcgttgttctaacaat
tatgggccgtaccagtatcccgagaaattaattccgttaatggttacgaatgcactggaa
ggaaaaaaactaccgttatatggtgatggtttaaatgtaagagattggttacatgtaacg
gatcattgtagtgcgattgacgttgttctgcataagggacgtgtaggagaagtatataat
ataggtggaaataatgaaaaaacaaatgtagaagttgtggaacaaattattactctttta
ggaaaaacaaaaaaagatatcgaatatgttacagatcgtttagggcacgatcgtcgttat
gcgattgatgcagagaaaatgaagaatgaatttgattgggaaccgaaatatacgtttgaa
caaggattacaagagacggtgaaatggtatgaaaagaataaggaatggtggaaactacta
aaagaccagtaa

DBGET integrated database retrieval system