KEGG   Bacillus thuringiensis HD-771: BTG_19775Help
Entry
BTG_19775         CDS       T02293                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bti  Bacillus thuringiensis HD-771
Brite
KEGG Orthology (KO) [BR:bti00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BTG_19775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: AFQ17373
UniProt: J3U5I4
LinkDB All DBs
Position
complement(3908792..3910207)
Genome map
AA seq 471 aa AA seqDB search
MKQIFQKKPIAKLMQESKQKTLARTLGALDLTMLGIGAIVGTGIFVLTGVVAAKHSGPAI
ILSFAIAALACAFAAFCYAEFASSVPVSGSVYTYTYATMGEVFAFLIGWDLMLEYLLATS
AVANGWSAYFQSLLKGFGIHIPTILSSAPGTGKGGIIDLPAVLIILVMTVLLSRGVRESA
RVNNIMVFIKIAVVLIFIFAGFNYVKPENWTPFMPFGLDGVMAGAATVFFAFIGFDAVST
AAEEVKRPQRDLPIGIIASLLICTVLYIVVSLILTGIVPYGQLNISDPVAFALQFIGQDG
LAGVISVGAITGITTVMLVMMYGQVRVSYAMSRDGLLPKRLAKVHPKFKTPFLNTWTTGI
IAALISGLIDLNVLAHLVNMGTLSAFALVAVAVIVMRRTHPDLPRVFKAPLVPFLPALTV
IFCLYLMLQLSGTAWISFGIWMVIGIAVYFLYSRKHSALNNSKKEEDVANL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatttttcaaaagaagccaattgcaaagttaatgcaagaaagtaagcaaaaa
acgttagcaagaacattgggcgcgctagatttaactatgcttggaatcggagcaattgtt
ggaactggtatttttgttctaacgggtgttgtggcagcgaaacattctgggccagctatt
atattatcatttgcgattgccgcgctagcttgtgcctttgctgcattttgttatgctgaa
tttgcttcttcagttcctgtatcgggcagtgtgtatacgtatacatacgcgacgatggga
gaagtattcgcatttttaattggctgggatctaatgcttgaatatttacttgctacatct
gctgtagcaaacggttggtctgcatattttcaatctttattaaaggggtttggaattcac
attccgactattctctcctcggctcctggtacagggaagggtggaataattgatctacct
gcagttctaattattttagtgatgacagttcttttatctaggggtgttcgtgaaagtgca
cgagtaaataacattatggtatttattaaaatagcagttgttcttatttttatctttgct
ggttttaattatgtgaaacctgaaaactggacgccttttatgccgtttggtttagatggt
gtaatggctggagcggctacagtattcttcgcatttataggatttgatgcagtttcaaca
gcggcagaagaagtgaaacgtccgcaacgtgatttaccaattggtattattgcatcgtta
ttaatttgtacagttctttatatcgttgtttcgcttattttgacaggaattgttccatac
ggacagttaaatatatcagatccagttgcttttgcacttcaatttattggacaagatggc
ttagctggagtaatttcagtaggagcaattacaggaattacaacagtaatgctagttatg
atgtatgggcaagttcgtgtttcttatgcgatgagccgagatggtttactgccgaagcgt
cttgctaaagttcatccgaaatttaaaacgccatttttaaatacatggacaacgggaatt
attgcggcactgatttcaggattaatagatttaaatgttttagcacatcttgtaaacatg
gggacattgtcagcatttgcactcgtagctgttgcggtaattgtaatgagaagaacccat
ccagacttaccaagggtatttaaggctccgcttgtaccgtttttaccagcgttaacagtg
attttctgtttatacttaatgcttcaattatcggggacagcatggattagttttgggata
tggatggttattggtatagcggtttacttcttatatagccgaaaacatagtgctttaaat
aatagtaaaaaagaagaagatgttgcgaatttataa

DBGET integrated database retrieval system