KEGG   Burkholderia thailandensis E444: BTJ_1662Help
Entry
BTJ_1662          CDS       T03112                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00020  Citrate cycle (TCA cycle)
btj00480  Glutathione metabolism
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
btj01130  Biosynthesis of antibiotics
btj01200  Carbon metabolism
btj01210  2-Oxocarboxylic acid metabolism
btj01230  Biosynthesis of amino acids
Module
btj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTJ_1662 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTJ_1662 (icd)
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BTJ_1662 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHI79126
LinkDB All DBs
Position
1:complement(1902078..1903337)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GTFRDAGYALAQKEFGAVLIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccctacatcgagggcgacggcacgggc
ttcgatatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtgtggctgccggaagagacgctgcaggtgctgaaggagtacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgattcagtacttcaagggcgttccc
tcgcccgtgcgcgagccggagaagaccaacatggtgatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcacgttccgtgacgccggctatgcgctcgcccagaaggagttcggcgcggtgctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgcgttcctgcagcagatcctgctgcgcccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgcttgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcaggcaaggactacgtgaacccgggttcggaaatcctg
tccgccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtcatcatcgcc
gcgatggaaaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system