KEGG   Burkholderia thailandensis E444: BTJ_3403Help
Entry
BTJ_3403          CDS       T03112                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00270  Cysteine and methionine metabolism
btj00450  Selenocompound metabolism
btj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTJ_3403
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BTJ_3403
Enzymes [BR:btj01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BTJ_3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHI82432
LinkDB All DBs
Position
2:complement(22991..24292)
Genome map
AA seq 433 aa AA seqDB search
MTYSSYHKKDIDGRPLHPETQMMSYGFDPFLSEGAVKPPVFLTSTFAFRSAEDGADFFDV
VSGRKPLPQGEAAGLVYSRFNHPNLEIVEDRLALLDGSDAAVVTSSGMSAISAIFLAFLR
PGDQLVQSVPLYGGTETLIAKYLRDWGVGAHPIDNGLSPQSIGAALEAAAQQGPVRLCYV
ETPANPTNALIDLDGMRRALDAFEARHGYRPISVCDNTLLGPIFQKPSEHGVDMSVYSLT
KYVGGHSDLVAGGVTGRRDLVAKVRAVRSAFGSQLDPHSSWMLIRSMETVVLRMKQAART
ASAVAKWLAANPYQKVDVYHPELIVDDAYQAVYKRQCTGAGSTFAFVLSGGRAEAFRFIN
ALHLFKSAVSLGGTESLICHPASTTHSGVPEAARKAAGVSEGLIRVSIGLEHEEDLIADL
DNAFRRSGIAAGG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcgagctatcacaagaaggacatcgacggccgtccgctgcatccggaaacg
cagatgatgtcgtacggattcgatccgtttttgtccgaaggcgcggtgaagcctccggtg
ttcctcacgtcgacgttcgcattccgctcggcggaggacggcgccgatttcttcgacgtc
gtgtcgggccgcaagccgctcccgcaaggcgaggcggcgggcctcgtctacagtcgcttc
aatcatccgaatctcgagatcgtcgaggatcgcctcgcgctgcttgacggctccgatgcg
gcggtcgtcacgtcgagcggaatgtcggcgatcagcgcgatctttctcgcattcctgcgg
cccggcgatcaactcgtgcaatcggtgccgctgtatggcggcacggaaacgctgatcgcg
aaatatctgcgcgactggggcgtcggcgcgcatccgatcgacaacggactgtcgccgcag
tcgatcggcgcggcgctcgaagccgccgcgcagcagggccccgtgcggctctgctatgtc
gagacgccggcgaatccgacgaacgcgctgatcgatctcgacggcatgcgccgcgcgctc
gacgcgttcgaagcgcgtcacggctatcgcccgatttcggtgtgcgacaacacgctgctc
gggccgatcttccagaagccgagcgagcacggcgtcgacatgtcggtgtattcgctgacc
aagtacgtgggcggccatagcgacctcgtcgcgggcggcgtcacggggcgccgggatctc
gtcgcgaaggtccgcgcggtgcgcagcgcgttcggctcgcaactcgatccgcattcgtcg
tggatgctgatccgctcgatggagacggtcgtgctgcggatgaagcaggcggcgcgcacc
gcgtcggcggtcgcgaagtggctcgcggcgaatccgtatcagaaggtcgatgtataccac
ccggagctgatcgtcgacgatgcttatcaggccgtgtacaagcggcaatgcaccggcgcc
ggctcgacgttcgcgttcgtgctgagtggcggtcgcgccgaagcattccggttcatcaat
gcgctgcatctgttcaagtccgcggtgagcctcggcggcaccgaatcgttgatttgccat
ccggcgtcgaccacgcactccggcgtgcccgaggcggcgcgcaaggcggcgggcgtgtcg
gaagggttgattcgcgtgtcgatcgggctcgagcacgaggaggatctgatcgccgatctc
gacaacgcgtttcgccggtccggcatcgcggcaggcggctga

DBGET integrated database retrieval system