KEGG   Burkholderia thailandensis E444: BTJ_3612Help
Entry
BTJ_3612          CDS       T03112                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00061  Fatty acid biosynthesis
btj00780  Biotin metabolism
btj01100  Metabolic pathways
btj01130  Biosynthesis of antibiotics
btj01212  Fatty acid metabolism
Module
btj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTJ_3612 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BTJ_3612 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BTJ_3612 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:btj01004]
    BTJ_3612 (fabI)
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BTJ_3612 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BTJ_3612 (fabI)
Lipid biosynthesis proteins [BR:btj01004]
 Fatty acid synthase
  Component type
   BTJ_3612 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AHI82013
LinkDB All DBs
Position
2:complement(322985..323746)
Genome map
AA seq 253 aa AA seqDB search
MRLQHKRGLIIGIANESSIAFGCARIMREQGAELATTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGQLEDVFARIAREWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVAHLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALESSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttcagcacaagcgtggcttgatcatcggcattgcaaacgaaagcagcatcgcg
ttcggctgcgcgcggatcatgcgcgagcagggcgccgagctcgcgaccacttacttgaac
gagaaggccgagccttatgtccggccgctcgcgcagcgtctggacagccggctcgtcgtg
ccgtgcgacgtgcgcgagcccggtcagctcgaggacgtgttcgcgcgcatcgcgcgcgag
tgggggcagctcgacttcgtgctgcactcgatcgcgtatgcgccgaaggaagacctccat
cgccgcgtgaccgactgctcgcaggcgggcttcgcgatggcgatggacgtgtcgtgccat
tcgttcattcgcgtcgcgcatctggccgagccgctgatgacgaacggcggctgtctgctg
acggtcacgttctacggcgccgagcgggcggtcgaggactacaacctgatggggcccgtg
aaggcggcgctcgaaagctcggtgcgctatctcgccgcggagctcgggccgcggcgcatc
cgcgtgcacgcgctgtcgccggggccgctgaagacgcgagccgcgtccggcatcgaccgc
ttcgacgcgctgctcgaacgcgtgcgcgagcgcacgcccggccatcgtctcgtcgacatc
gacgacgtcggccacgtcgccgcgttcctcgcgagcgacgacgcggccgcgctgacgggc
aacgtcgagtacatcgacggcggctatcacgtcgtcggctga

DBGET integrated database retrieval system