KEGG   Burkholderia thailandensis E444: BTJ_3810Help
Entry
BTJ_3810          CDS       T03112                                 

Definition
(GenBank) lysozyme family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
btj  Burkholderia thailandensis E444
Brite
KEGG Orthology (KO) [BR:btj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btj02044]
    BTJ_3810
Secretion system [BR:btj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTJ_3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AHI81524
LinkDB All DBs
Position
2:complement(571955..572386)
Genome map
AA seq 143 aa AA seqDB search
MSDLQLYNKLSRRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPM
QMAGATKINPVHAAAHICEVIRRFEPRVDPVATTVKPRTESRKRLAQTIYFDVSMKARED
GAELRASLALDYLSGYFSLADDH
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcttcaactctacaacaagctgtcgagacggattcgtcgccattcgcttcaa
gaggtcgtggccgatcacttggtcgatctgatgaatcacgcgatccgcggtgcgcgcatg
cgcatcgcggacgacagcccggccgcgcattcggtgttgaacttcggctgtccgccgatg
cagatggccggcgcgacgaagatcaatccggttcacgcggccgcgcacatctgcgaggtg
attcgtcgcttcgagccgcgcgtggatcccgttgccacgacggtcaaacctcggaccgag
agccgcaagcgcctcgcgcagacgatctatttcgatgtatcgatgaaggcgcgcgaagac
ggagccgagctcagggcgagcctcgcgctcgattacctgagcggctatttcagcctggcg
gacgaccattga

DBGET integrated database retrieval system