KEGG   Burkholderia thailandensis E444: BTJ_4544Help
Entry
BTJ_4544          CDS       T03112                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00500  Starch and sucrose metabolism
btj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTJ_4544 (cga)
Enzymes [BR:btj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BTJ_4544 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AHI81507
LinkDB All DBs
Position
2:complement(1464979..1467624)
Genome map
AA seq 881 aa AA seqDB search
MSAKHLGFKQAVLVGSLAALACAAFLPAHASAAEAFGSPGATAVRGPSAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAVQTDTRTMSW
QVTTSNGSHNWQIRKIIFADPNYNAIVQRVTFTALNGHKVGDFNLYLLSKPYLDNAGGGN
AAQTVSGSGGTALVANHNSRYSALVTSRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQTGWIDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGGDLAGE
QQQYDTAWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTNCGIAEYNASGCAQGYS
RIGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLSAADYWQENVAAWTYT
SSGTFGNGSYYIRINPAGRSGTGTDRASFAPTAGPDTPQTLTVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIVNTISVYDSVLGQTLSLANAPALSPNAWFRYNFDGYGEHNDGSD
FDGTGAGRLWPIFTAERGMVEIARQGNGNAGSAYFSTLKQLTTPEGFLPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYSNCVAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPANYPVWSNTVNLPAAQA
IQYKYYRKNADGSVTWENGSGNRQLQTPASGTLTLNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaagcacttaggtttcaaacaggcggtgctggttggcagtctggccgcgctc
gcgtgcgcggcgttcttgcccgcgcatgcttcggctgccgaagcattcggctcgcccggc
gcaacggccgtgcgaggcccctcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtctatttcaccggttatcggggcatcctgtccgaggtctactatccggttctc
gatacgccggagtccgtcgacctgcagttcctggtcggcgatgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgtgcaaacggacacgcgcacgatgagctgg
caagtgacgaccagcaacggttcgcataactggcaaatccgcaagatcatcttcgccgat
ccgaactacaacgcgatcgtgcaacgcgtcacgttcaccgcgctcaacggccacaaggtc
ggcgatttcaatctttacctgctgtccaagccgtacctcgacaacgccggcggcggcaac
gccgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcacgagccgcccgtggaaagtggtcaacggcgtcggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggacgttctcgtccgcgaccaacggcaacgtcgcgcagacgggctggatc
gatctcggcgacccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacaccgtgctcggcggcgatctcgccggcgag
cagcagcagtacgacaccgcatggcacaactatgcggcgggcctgtcgtcgcagaacggc
gccgcggatgacggctactatctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggccggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctgcag
cagacgacgaactgcggcatcgccgaatacaacgcgtccggctgcgcgcagggctacagc
cgcatcgggcgcttcccgcagaacgcgtgggtgaacggctggccgtactggcaaggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcggctcggcccgagcgtgttc
aatccgttgtggccgaagatcaagctcaccgccgattacatcgtcaacaccggcccgtgg
acgtatcaggagcgctgggaggaaaacgccggctactcgccgtcgacgatcgcggccgag
atcgcgggcctcgtcacggcggcggacatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctctccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcacgttcggcaacggcagctactacatccggatcaatccggcgggccgctcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgaccgtgaagaacggcggcggcagccacgatgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggcgtcaagcgcgcgaccgatccgacgatcgtcaacacgatc
tcggtctacgacagcgtgctcggccagacgctgagtctcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaatgacggcagcgac
ttcgacggcaccggcgcgggccgcctgtggccgatcttcaccgccgagcgcgggatggtc
gagatcgcgcgccagggtaacggcaacgcgggcagcgcgtacttctcgacgctcaagcaa
ctgacgacgcccgagggcttcctgccggaacaggtatggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgccggctacacgccggggcagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgagtacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtagtctgcgcgcgctacagcaactgcgtcgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacgggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgatccggccaactacccggtgtggagcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaacgggtcc
ggcaaccgccagcttcagacgcccgcgagcggcacgctgacgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system