KEGG   Burkholderia thailandensis E444: BTJ_4755Help
Entry
BTJ_4755          CDS       T03112                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00010  Glycolysis / Gluconeogenesis
btj00071  Fatty acid degradation
btj00350  Tyrosine metabolism
btj00625  Chloroalkane and chloroalkene degradation
btj00626  Naphthalene degradation
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
btj01130  Biosynthesis of antibiotics
btj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTJ_4755
  Lipid metabolism
   00071 Fatty acid degradation
    BTJ_4755
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTJ_4755
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTJ_4755
   00626 Naphthalene degradation
    BTJ_4755
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTJ_4755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AHI81240
LinkDB All DBs
Position
2:1720183..1721208
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVTAVGGGVKHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAHEKLELARKLGAAFVVDASRDDPAAVIQKEIGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLENINSVFTALREGKVDGRIVLTGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtacacgcattcggcgaaccgcttcgcatcgag
gaagtccccgtgccgacgcctggcccgggccagatcctcgtgaacatcaaggcgtcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtgacggcggtgggcggcggcgtcaagcac
gtgaaagagggcgatcgcgtcggcgtgccgtggctctacaccgcatgcggccattgcgag
tattgccagaccggctgggaaacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagttatgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgaaatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgcgtgaccgatacgcgccccggccaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtccagtacgcgaaggcgatggggctgcacgtcgtcgcggtcgacgtc
gcgcacgagaagctcgagcttgcgcgcaagctgggtgcggcgttcgtcgtcgacgcgtcg
agggacgatcccgccgcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcggcatggtgcggcgaggcgggacg
gtatcgttgaacgggctgccgccgggggattttccgctgccgattttctcgacggtgctc
aacgggatcacggtgcgcggctcgatcgtcggcacgcggcgcgatcttcaggagtcgctc
gacttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctggagaacatc
aatagcgtgttcacggcgctgcgcgaagggaaggtcgacgggcggatcgtgttgaccggg
gagtga

DBGET integrated database retrieval system