KEGG   Burkholderia thailandensis E444: BTJ_4811Help
Entry
BTJ_4811          CDS       T03112                                 

Definition
(GenBank) ring hydroxylating alpha subunit family protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00627  Aminobenzoate degradation
btj01100  Metabolic pathways
btj01120  Microbial metabolism in diverse environments
Module
btj_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTJ_4811
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BTJ_4811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AHI82210
LinkDB All DBs
Position
2:1782706..1783983
Genome map
AA seq 425 aa AA seqDB search
METTESPVLPIDRADSSDVRFPHDDGSRVPYKVFSSQAVYDREQERIFRGPTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRGEDGALAAWVNRCAHRGAQVCRQARGNASSHTCVYHQW
SFDSCGNLLGVPFRRGQKGMTGMPADFDPKNHGLRKLRVDSYKGLVFATFSDDVAPLPDY
LGPQMRPWIDRIFHKPIEYLGCTRQYSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTREDTDTASAYRQQNIRSFDEGFSLEDDSILGLVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIKQAN
LVGPAGYISMEDTEATELVQRGTARDADAASVIEMSRGNPDQQDTAITESLIRKFWVGYQ
KLMGY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaccgaatcgccggtattgccgatcgatcgcgccgattcgtccgacgtgcga
ttcccgcacgacgacggctcgcgcgtgccgtacaaggtgttcagctcgcaagcggtgtac
gaccgcgagcaggagcggatctttcgcgggccgacgtggaatttcgtcgcgctcgaagcg
gaaatcccgaaaccgggcgacttcaagagcacgttcgtcggcgacacgcccgtcgtcgtc
acgcgcggcgaggacggcgcgctcgccgcttgggtgaaccgctgcgcgcatcgcggcgcg
caggtgtgccgccaggcgcgcggcaacgcgagctcgcacacctgcgtctaccaccagtgg
agcttcgatagctgcggcaacctgctcggcgtgccgtttcggcgcgggcagaagggcatg
accgggatgccagccgatttcgatccgaagaatcacgggctgcgcaagctgcgcgtcgac
agctacaagggcctcgtgttcgcgacgttcagcgacgacgtcgcgccgttgcccgactac
ctcggcccgcagatgcggccgtggatcgaccggatcttccacaagccgatcgagtatctc
ggctgcacgcgccagtactcgaaatcgaactggaagctgtacttcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgacgttcaatattttccgagtcggg
atgaaggcgcgctcgattccggacgcgacgcacgggctgcacagcatcatcacgatgacg
aagacgcgcgaggacacggataccgcgagcgcgtacaggcagcagaacatccgttcgttc
gacgaaggtttctcgctcgaggacgactcgatccttggcctcgtgtccgagtacgacgag
gacacgacgaaccacatccagccgatctttccgcagctcgtgatccagcagatccacaac
acgctcgtcgcgcgccagttgctgccgaaagggccgaagaacttcgagctgatctttcac
ttcttcggctacgcggacgatacgcccgagctgcgcgatttgcggatcaagcaggcgaac
cttgtcgggcccgcgggctacatctcgatggaggacaccgaggcgaccgagctcgtccag
cgcggcacggcgcgcgatgcggacgcggcatcggtgatcgagatgtcgcgcggcaatccg
gaccagcaggacacggcgatcaccgagagcctgatccgcaagttctgggtcggctaccag
aagctgatgggctattga

DBGET integrated database retrieval system