KEGG   Burkholderia thailandensis E444: BTJ_4986Help
Entry
BTJ_4986          CDS       T03112                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00020  Citrate cycle (TCA cycle)
btj00190  Oxidative phosphorylation
btj00650  Butanoate metabolism
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
btj01130  Biosynthesis of antibiotics
btj01200  Carbon metabolism
Module
btj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTJ_4986 (sdhA)
   00650 Butanoate metabolism
    BTJ_4986 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTJ_4986 (sdhA)
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTJ_4986 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BTJ_4986 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 DAO Thi4 Pyr_redox_2 HI0933_like GIDA FAD_oxidored Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHI80782
LinkDB All DBs
Position
2:1977122..1978897
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGMRASLQLSRAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKNQKEHKPLPADAAEFSLSRLAKLEKSTSGEYTQDIANDIRATMQKHAGVFRTS
ALLKEGVEQMAGLKERAASVHLKDKSKVFNTARVEALELANLIEVARATMVSAEARKESR
GAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQMKPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgtcgcaagttcgacgtggtgatcgtcggcgcg
ggcggctcggggatgcgcgcgtcgctgcaactgtcgcgcgcgggcctctccgtatgcgtg
ctgtcgaaggtgttcccgacccgttcgcacacggtcgccgcgcaaggcgggatcggcgcg
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagcgccgaacgtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgtaacgcggacggcacgatctac
cagcgtccgttcggcggccacacggccaactacggcgagaagccggttcagcgcgcgtgc
gcggcggccgaccgcaccggccacgcgctgctgcacacgctgtaccagcagaacgtcgcg
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgaaatggaaacgggcgacgtctacatcctcgaaggc
aagaccacgctgttcgccacgggcggcgcgggccggatcttcgcggcgtcgaccaacgcg
ttcatcaacaccggcgacggcctcggcatggcggcccgctcgggcatcgcgctgcaggac
atggagttctggcaattccacccgacgggcgtcgcgggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcattctgcgcaacgcgaacggcgagcgcttcatggagcgc
tacgcgccgacgctgaaggatctggcgccgcgcgatttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtgggcccgaacaaggatcacgtgctgctcgacctgtcg
cacatcggcgcggagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggaaccgattcccgtcgtgccgacgatccactaccag
atgggcggcatcccgaccaacatccacggccaggtggtgggcacgtcgcgcgatcacaag
gagccgatcaacggcttctacgcggtgggcgaatgctcgtgcgtgtccgtgcacggcgcg
aaccgtctcggcacgaactcgctgctcgacctcgtcgtgttcggccgcgcggccggcaac
cacatcgtcgagcacgtgaagaaccagaaggagcacaagccgctgccggccgacgccgcc
gaattctcgctgtcgcgcctcgcgaagctcgagaagtcgacgtcgggcgagtacacgcag
gacatcgcgaacgacatccgcgcgacgatgcagaagcacgccggcgtgttccgcacgtcc
gcgttgctcaaggaaggcgtcgagcagatggcgggcctgaaggagcgcgctgccagcgtc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgaactggcg
aacctgatcgaggtcgcgcgcgcgacgatggtgtcggcggaagcgcgcaaggaaagccgc
ggcgcgcacgcgcacagcgattacgagcaccgcgacgacgagaactggctgcgtcacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagcccgtccaaatgaagccgctgacg
gtcgagtccgtgccgccgaaggcgcgtacgttctaa

DBGET integrated database retrieval system