KEGG   Burkholderia thailandensis E444: BTJ_4987Help
Entry
BTJ_4987          CDS       T03112                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00020  Citrate cycle (TCA cycle)
btj00190  Oxidative phosphorylation
btj00650  Butanoate metabolism
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
btj01130  Biosynthesis of antibiotics
btj01200  Carbon metabolism
Module
btj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
btj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTJ_4987
   00650 Butanoate metabolism
    BTJ_4987
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTJ_4987
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTJ_4987
    1.3.5.4  fumarate reductase (quinol)
     BTJ_4987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: AHI82765
LinkDB All DBs
Position
2:1978919..1979620
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcatttttgaaatctaccgctacgatccggacaaggacgccgcgccgcgc
atgcagacgtacgagctggagatccagcacgagcggatgctgctcgatgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggcctgcccgtcgtgcgcgacctgatc
tgcgatttcacgcagttcttcaaccagtaccactcgatccgtccgtacctgatcaacgac
gagccgccgcccgagaaggagcgcctgcagtcgccggaagagcgcgatgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgatcgcgcgacgggcgagcgcctcgacaacctcgacgatccgtaccgtctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgccgcacggtctga

DBGET integrated database retrieval system