KEGG   Burkholderia thailandensis E444: BTJ_5308Help
Entry
BTJ_5308          CDS       T03112                                 

Definition
(GenBank) class II Aldolase and Adducin N-terminal domain protein
  KO
K22130  3-dehydro-4-phosphotetronate decarboxylase [EC:4.1.1.104]
Organism
btj  Burkholderia thailandensis E444
Brite
KEGG Orthology (KO) [BR:btj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTJ_5308
Enzymes [BR:btj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.104  3-dehydro-4-phosphotetronate decarboxylase
     BTJ_5308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AHI81088
LinkDB All DBs
Position
2:complement(2364974..2365615)
Genome map
AA seq 213 aa AA seqDB search
MSTVETKLRDEICEIGASLHARGHAAGSAGNISAKLDDGWLITPTDACLGRLDPADIAKV
DLAGHAVSGGKPSKTLALHRGIYARNAEARGIVHTHSTHLVALTLAGVWSEADVLPPITP
YYVMKVGHIPLIRYRRPGDPAVAAEVAALADRVRGVLLERLGPVVWGPSVAHASYALEEL
EETARLWLITHPKPEPLGESALAELRDAFGARW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtcgagacgaaactgcgcgacgagatctgcgagatcggcgcgagcctccac
gcgcgcggccacgcggccggcagcgcgggcaacatcagcgcgaagctcgacgacggctgg
ctcatcacgccgaccgatgcgtgccttggccggctcgacccggccgacatcgcgaaggtc
gatctcgcgggccacgcggtatcgggcggcaagccgtcgaagacgctcgcgctgcatcgc
gggatctacgcgcgcaacgccgaagcgcgcggcatcgtccacacgcactcgacgcacctc
gtcgcgctcacgctcgcgggcgtctggagcgaggccgacgtgctgccgccgatcacgccg
tactacgtgatgaaggtcggccacattccgctcattcgctatcgccggccgggcgacccg
gcggtggccgccgaagtcgcggcgctcgccgatcgcgtgcgcggcgtgctgctcgagcgg
ctcggccccgtcgtctggggcccgtcggtcgcgcacgcatcgtacgcgctcgaggaactc
gaggagaccgcgcgcctctggctgatcacgcatccgaaacccgagccgctcggcgagtcc
gcgctggccgaattgcgcgacgcgttcggcgcgcgctggtaa

DBGET integrated database retrieval system