KEGG   Burkholderia thailandensis E444: BTJ_5441Help
Entry
BTJ_5441          CDS       T03112                                 

Gene name
sorD
Definition
(GenBank) sorbitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00040  Pentose and glucuronate interconversions
btj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTJ_5441 (sorD)
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BTJ_5441 (sorD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AHI80563
LinkDB All DBs
Position
2:complement(2532627..2533661)
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARDLALRDIDLPLEVGPADVKIRIHTVGVCGSDVHYYTHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTHLRAGDRVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPQNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFASNRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNAKAYAGIVDLLCPNGCLVLVGMPLEPVPLDVVALQAKEARIESVFRYANVFPRALA
LIESGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgatctcgcgctgcgcgacatcgacctgccg
ctcgaggtcggccccgccgacgtcaagatccgcatccacacggtgggcgtctgcggcagc
gacgtccactattacacgcacggcgggatcggcccgttccgggtcgacgcgccgatggtg
ctcggccacgaggcgtccggcacggtcgtcgaggtcgggcgcgacgtcacgcacctgcgc
gcgggcgaccgcgtctgcatggaacccggcgtcccgcgcttcgattcgaaggcgacactg
cacggcctctacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcatccggcggcgttcacgtaccggctgccgcagaacgtg
tcgttcgccgagggcgcgattgtcgagccgctcgcgatcgggctgcaggccgcgaagaaa
gcggcgatgaagccgggcgacatcgcggtcgtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgattctggccgacgtcgtcaag
gagaagctcgcgctgttcgcgtcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgacgcggtcgcgcacgcgaccgacggctggggcgcggacgtcgtgttcgag
gcgagcggcaacgcgaaggcctatgcgggaatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgaaccggtgccgctcgacgtcgtcgcgctgcaggcg
aaggaggcgcggatcgaatcggtgttccgctacgcgaacgtctttccgcgcgcgctcgcg
ctgatcgaatccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system