KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0290Help
Entry
BT9727_0290       CDS       T00179                                 

Gene name
gatB
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00970  Aminoacyl-tRNA biosynthesis
btk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BT9727_0290 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:btk03029]
    BT9727_0290 (gatB)
Enzymes [BR:btk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BT9727_0290 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BT9727_0290 (gatB)
Mitochondrial biogenesis [BR:btk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BT9727_0290 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-GeneID: 2856345
NCBI-ProteinID: YP_034640
UniProt: Q6HP80
LinkDB All DBs
Position
342588..344015
Genome map
AA seq 475 aa AA seqDB search
MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAM
KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVDGKKKRIGITR
LHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEAYAYLEKLKSIIQYTGVS
DCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQKGLEHEQVRQEKELLSGGI
IQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDAWKEEVRASIPELPDARK
ARYVAELGLPAYDAHVLTLTKEMSDFFEATVADGADAKLTSNWLMGEVLAYLNKQQKELK
DVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGDPEEIVKAKGLVQISDEGTLRK
VVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQANPPLVNKILLEEINKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaaacaattattggtttagaggttcacgttgagttaaaaacaaattcgaaa
attttctctgcgagtccaacagaattcggagcggaaccaaatacacaaacaagtgtaatt
gacttaggatacccaggggtacttcctactttaaataaagaagcagttaactttgcaatg
aaagctgcaatggcattaaactgtgaaatcgcaacggaaacgaagttcgaccgtaaaaac
tatttctacccagataatccgaaagcttaccaaatttctcaatttgataagccaattggt
gaaaatggctggattgaaatcgaagtagacggtaaaaagaaacgtatcggtattacacgt
cttcatttagaagaagatgctggtaaatcaacgcatacagctgatggttcattagtagac
tataaccgtcaaggtatgcctttaatcgagatcgtgtctgagccagatatgcgtacgcca
gaagaagcatatgcatacttagagaagttaaaatcaatcattcaatacactggcgtatct
gattgtaagatggaagaaggttccttgcgttgtgatgcgaacatctctcttcgtccagtt
ggacaagagaagttcggtacaaaagcagaactgaaaaacttaaactcattcacttacgta
caaaaaggtcttgagcatgagcaagtgcgtcaagaaaaagaattattatctggtggtatc
atccaacaagaaacacgtcgttatgatgaagcaacgaagaaaacaatcttaatgcgtgta
aaagaaggatctgacgattaccgttacttcccagagccagacttagttgaactttacatc
gatgacgcgtggaaagaagaagttcgtgcttctattccagaacttccagatgcacgtaaa
gctcgctacgttgcagaactaggcttaccagcttatgatgcacacgtattaacattaaca
aaagaaatgtctgatttctttgaagcaactgttgcagacggtgctgatgcgaaattaaca
tcaaactggttaatgggtgaagtgcttgcgtacttaaacaaacaacaaaaagaattaaaa
gatgttgcattaacgcctgctggtttatctaaaatggttcaattaattgaaaaaggtaca
atttcttctaaaattgcgaagaaagtatttaacgaattaattgaaaaaggtggagatcca
gaagaaatcgttaaagcgaaaggtcttgttcaaatttctgacgagggtacacttcgtaaa
gttgtaacagaaattcttgataataatgaacaatctatcgaagactttaaaaacggtaaa
gaccgtgcgattggcttcttagttggtcaaattatgaaagctacaaaaggacaagcaaat
ccaccgctagttaacaaaatcttacttgaagagattaataagcgataa

DBGET integrated database retrieval system