KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0313Help
Entry
BT9727_0313       CDS       T00179                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Brite
KEGG Orthology (KO) [BR:btk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BT9727_0313 (ahpF)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BT9727_0313 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 2858038
NCBI-ProteinID: YP_034663
UniProt: Q6HP57
LinkDB All DBs
Position
complement(371651..373177)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagtaagcgcaggaaacgacgacgtatctaaagatatgttagctcta
gtagacgaattagctactatgtcatctaagatcacagtagaaaaagtcgaactagagaga
acaccaagctttagcgtaaatcgccctggtgaagacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacatcactagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttctaaactctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaacagttttcctaaacggcgaatctttc
ggcagcggtcgtatgacactggaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggcattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatatgacatcgatgta
atgaatctacaacgtgcaaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttcaacaggtgctcgctggcgtaac
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatactgcccacactgt
gacggtccattattcactggaaaagacgtagcagttatcggcggcggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagaacgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaattactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgttccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system